Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A401GG14

Protein Details
Accession A0A401GG14    Localization Confidence Low Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
2-25SETTVQPVSRPRKRRLPRAYGYAFHydrophilic
84-106FADNCSRKRKKPDEDLVQRVKKAHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 15, mito_nucl 12.833, nucl 8.5, cyto_nucl 6.666
Family & Domain DBs
Amino Acid Sequences MSETTVQPVSRPRKRRLPRAYGYAFNWAILAPLARELDFPDVTLSNLVNTYFRFRFYLMNTWDVPNECFRNLSTKGNLTVGVVFADNCSRKRKKPDEDLVQRVKKAMKMEEDPKWYYLV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.73
2 0.82
3 0.83
4 0.83
5 0.81
6 0.82
7 0.8
8 0.74
9 0.67
10 0.64
11 0.53
12 0.43
13 0.36
14 0.26
15 0.21
16 0.15
17 0.13
18 0.05
19 0.08
20 0.08
21 0.08
22 0.09
23 0.1
24 0.13
25 0.13
26 0.13
27 0.12
28 0.12
29 0.12
30 0.13
31 0.11
32 0.07
33 0.08
34 0.08
35 0.07
36 0.07
37 0.12
38 0.12
39 0.13
40 0.14
41 0.14
42 0.17
43 0.19
44 0.26
45 0.23
46 0.25
47 0.25
48 0.25
49 0.25
50 0.23
51 0.21
52 0.17
53 0.16
54 0.14
55 0.14
56 0.13
57 0.18
58 0.2
59 0.23
60 0.22
61 0.22
62 0.24
63 0.24
64 0.24
65 0.18
66 0.16
67 0.13
68 0.11
69 0.09
70 0.07
71 0.07
72 0.12
73 0.14
74 0.16
75 0.24
76 0.29
77 0.35
78 0.46
79 0.55
80 0.6
81 0.68
82 0.76
83 0.79
84 0.84
85 0.87
86 0.87
87 0.82
88 0.73
89 0.65
90 0.58
91 0.5
92 0.46
93 0.42
94 0.39
95 0.42
96 0.49
97 0.53
98 0.57
99 0.56