Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A401GI09

Protein Details
Accession A0A401GI09   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
98-126DGPGGKAEKRRMRQENRKRIRDQNFMKTQHydrophilic
NLS Segment(s)
PositionSequence
103-116KAEKRRMRQENRKR
Subcellular Location(s) mito 23.5, cyto_mito 13
Family & Domain DBs
InterPro View protein in InterPro  
IPR013870  Ribosomal_L37_mit  
Gene Ontology GO:0005739  C:mitochondrion  
GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF08561  Ribosomal_L37  
Amino Acid Sequences MSLLHALRRPPRLNICCVVRRAYTSKGEAPKNVGMKAETPVDGEESPAGTFSKSSCEPNTILDGLAYLKDQPPVIALPDEEYPEWLWTLLSPKVLEDDGPGGKAEKRRMRQENRKRIRDQNFMKTQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.6
2 0.61
3 0.58
4 0.58
5 0.54
6 0.45
7 0.46
8 0.44
9 0.43
10 0.4
11 0.39
12 0.43
13 0.46
14 0.47
15 0.44
16 0.45
17 0.45
18 0.43
19 0.39
20 0.33
21 0.27
22 0.25
23 0.25
24 0.22
25 0.17
26 0.14
27 0.14
28 0.15
29 0.14
30 0.13
31 0.11
32 0.09
33 0.09
34 0.09
35 0.09
36 0.06
37 0.06
38 0.06
39 0.1
40 0.11
41 0.14
42 0.14
43 0.17
44 0.17
45 0.18
46 0.21
47 0.16
48 0.15
49 0.12
50 0.11
51 0.09
52 0.08
53 0.07
54 0.05
55 0.06
56 0.07
57 0.07
58 0.06
59 0.07
60 0.07
61 0.08
62 0.08
63 0.08
64 0.09
65 0.1
66 0.11
67 0.1
68 0.11
69 0.1
70 0.1
71 0.11
72 0.09
73 0.08
74 0.07
75 0.11
76 0.11
77 0.12
78 0.12
79 0.12
80 0.14
81 0.14
82 0.13
83 0.11
84 0.14
85 0.13
86 0.14
87 0.14
88 0.13
89 0.17
90 0.22
91 0.3
92 0.35
93 0.42
94 0.51
95 0.62
96 0.71
97 0.79
98 0.85
99 0.87
100 0.89
101 0.91
102 0.88
103 0.88
104 0.86
105 0.85
106 0.83