Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A401GIJ0

Protein Details
Accession A0A401GIJ0    Localization Confidence Medium Confidence Score 12.4
NoLS Segment(s)
PositionSequenceProtein Nature
294-313QLSRSQAKKRGGKKAVPEESHydrophilic
NLS Segment(s)
PositionSequence
301-307KKRGGKK
323-333PPKTQKRKGRR
Subcellular Location(s) mito 12, mito_nucl 11.833, nucl 10.5, cyto_mito 8.833
Family & Domain DBs
InterPro View protein in InterPro  
IPR011513  Nse1  
IPR014857  Nse1_RING_C4HC3-type  
IPR036388  WH-like_DNA-bd_sf  
IPR001841  Znf_RING  
IPR013083  Znf_RING/FYVE/PHD  
Gene Ontology GO:0005634  C:nucleus  
GO:0030915  C:Smc5-Smc6 complex  
GO:0046872  F:metal ion binding  
GO:0016740  F:transferase activity  
GO:0006310  P:DNA recombination  
GO:0006281  P:DNA repair  
Pfam View protein in Pfam  
PF07574  SMC_Nse1  
PF08746  zf-RING-like  
PROSITE View protein in PROSITE  
PS50089  ZF_RING_2  
Amino Acid Sequences MVSSNDVQRLFLQSMLSRRIISQKLALKIWEKCVEAVRAADDSLEIPFSSDRNSWDNFVSNINNALNPLDLEFAHMHDEYTGKEMCVLVNRRGDEIAQMATDYSAVEIAYFKAVVEQIMLAPNESYTVSSLAALREVGTLKANMTKTQAEVVLSSFVAKGWLVKSREGRYSLSTRTLLELQPYLRSTYPDEIIECTICMEMITRGVACYTAHCKTRLHTHCFNNYRRRNQNCPTCNENWSADANARKLLSIGEGAFKDGQDKGSRRAPRKSAAEGDEDEDEEMDVEPSPSQLSQLSRSQAKKRGGKKAVPEESMDVDEDRPTPPKTQKRKGRR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.32
3 0.32
4 0.28
5 0.29
6 0.36
7 0.36
8 0.35
9 0.37
10 0.39
11 0.42
12 0.43
13 0.45
14 0.43
15 0.44
16 0.49
17 0.47
18 0.41
19 0.38
20 0.41
21 0.4
22 0.36
23 0.33
24 0.27
25 0.22
26 0.21
27 0.19
28 0.14
29 0.12
30 0.11
31 0.1
32 0.08
33 0.08
34 0.09
35 0.09
36 0.12
37 0.14
38 0.16
39 0.19
40 0.21
41 0.22
42 0.24
43 0.26
44 0.24
45 0.26
46 0.24
47 0.21
48 0.23
49 0.22
50 0.2
51 0.18
52 0.17
53 0.13
54 0.12
55 0.11
56 0.09
57 0.08
58 0.11
59 0.11
60 0.11
61 0.14
62 0.14
63 0.13
64 0.12
65 0.13
66 0.1
67 0.13
68 0.13
69 0.1
70 0.11
71 0.11
72 0.11
73 0.19
74 0.22
75 0.23
76 0.28
77 0.29
78 0.29
79 0.29
80 0.28
81 0.22
82 0.2
83 0.15
84 0.1
85 0.1
86 0.09
87 0.08
88 0.08
89 0.06
90 0.05
91 0.04
92 0.04
93 0.04
94 0.04
95 0.05
96 0.05
97 0.05
98 0.05
99 0.06
100 0.07
101 0.06
102 0.06
103 0.06
104 0.06
105 0.09
106 0.09
107 0.08
108 0.08
109 0.08
110 0.08
111 0.08
112 0.08
113 0.06
114 0.07
115 0.07
116 0.07
117 0.08
118 0.08
119 0.08
120 0.07
121 0.07
122 0.07
123 0.08
124 0.08
125 0.08
126 0.08
127 0.08
128 0.13
129 0.13
130 0.13
131 0.15
132 0.15
133 0.15
134 0.16
135 0.16
136 0.11
137 0.11
138 0.11
139 0.09
140 0.08
141 0.08
142 0.07
143 0.06
144 0.06
145 0.06
146 0.06
147 0.06
148 0.13
149 0.14
150 0.18
151 0.23
152 0.25
153 0.29
154 0.3
155 0.31
156 0.28
157 0.31
158 0.29
159 0.27
160 0.25
161 0.22
162 0.22
163 0.22
164 0.18
165 0.16
166 0.16
167 0.13
168 0.15
169 0.15
170 0.15
171 0.14
172 0.15
173 0.16
174 0.17
175 0.18
176 0.16
177 0.16
178 0.15
179 0.16
180 0.14
181 0.12
182 0.1
183 0.08
184 0.07
185 0.06
186 0.05
187 0.05
188 0.05
189 0.06
190 0.05
191 0.05
192 0.06
193 0.06
194 0.06
195 0.08
196 0.12
197 0.15
198 0.18
199 0.2
200 0.21
201 0.22
202 0.33
203 0.38
204 0.41
205 0.45
206 0.49
207 0.58
208 0.65
209 0.71
210 0.71
211 0.72
212 0.75
213 0.76
214 0.77
215 0.76
216 0.77
217 0.79
218 0.75
219 0.72
220 0.69
221 0.63
222 0.59
223 0.53
224 0.46
225 0.37
226 0.33
227 0.28
228 0.25
229 0.25
230 0.23
231 0.22
232 0.21
233 0.19
234 0.17
235 0.16
236 0.14
237 0.12
238 0.12
239 0.13
240 0.13
241 0.15
242 0.15
243 0.15
244 0.16
245 0.14
246 0.17
247 0.2
248 0.23
249 0.26
250 0.34
251 0.42
252 0.47
253 0.55
254 0.57
255 0.58
256 0.62
257 0.63
258 0.62
259 0.57
260 0.56
261 0.49
262 0.46
263 0.38
264 0.33
265 0.26
266 0.19
267 0.16
268 0.11
269 0.1
270 0.08
271 0.07
272 0.07
273 0.07
274 0.07
275 0.08
276 0.08
277 0.08
278 0.11
279 0.14
280 0.18
281 0.24
282 0.29
283 0.35
284 0.42
285 0.49
286 0.54
287 0.61
288 0.65
289 0.69
290 0.74
291 0.75
292 0.76
293 0.78
294 0.8
295 0.79
296 0.73
297 0.67
298 0.59
299 0.54
300 0.49
301 0.4
302 0.3
303 0.23
304 0.22
305 0.2
306 0.19
307 0.2
308 0.21
309 0.27
310 0.36
311 0.46
312 0.55
313 0.65