Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A401H393

Protein Details
Accession A0A401H393   
Localization Confidence Medium
Confidence Score 11.7
NoLS Segment(s)
PositionSequenceProtein Nature
4-32VDAIRRKVEKVKKAEKAERRARLHQQEANHydrophilic
NLS Segment(s)
PositionSequence
8-25RRKVEKVKKAEKAERRAR
Subcellular Location(s) nucl 11, mito 7, plas 6, cyto_nucl 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR045341  DUF6532  
Pfam View protein in Pfam  
PF20149  DUF6532  
Amino Acid Sequences MFTVDAIRRKVEKVKKAEKAERRARLHQQEANGEEVNEDEIEQSDVDDVEDYMFTDRTVTTKLSAKKALPYRADRLPLAATTNKGRRNTDETPPLVVPSDDDRNDDDEPVVIRRHVLKANVTRIVIEDNVDAVTITLSAFKKRGCDDDNDDGSDGECDGPMQPKYQKGSDGSSRPRVKDFDDATQEVLTITIAIFRCMVSTEAPFPDTSTFEIEMAQQAWKKACEQTGLNVMVMTTLIKMIMKRTSHIRGELKTKVRGIIQSFYGFQSGENKSAILRNCQRAEDLKDGYSFVYEDPAMKKGLYKSEIIQMVINDMWFANKHDEGVRYHGYFNPMPVVTIALVLAAVECGIDEWATGIKEDVPFTAASYKEVYQAHLHCLHDFEKHTINYGILRKRCNLWHGNARFHSGAEPISKTTVPALDMSAFEAAIREWEESETNDSDNEAVPGMEGA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.67
2 0.72
3 0.79
4 0.85
5 0.85
6 0.87
7 0.87
8 0.87
9 0.84
10 0.83
11 0.84
12 0.83
13 0.82
14 0.76
15 0.72
16 0.7
17 0.64
18 0.6
19 0.5
20 0.4
21 0.32
22 0.27
23 0.22
24 0.15
25 0.13
26 0.08
27 0.08
28 0.09
29 0.09
30 0.09
31 0.08
32 0.08
33 0.08
34 0.08
35 0.08
36 0.07
37 0.07
38 0.08
39 0.09
40 0.09
41 0.09
42 0.09
43 0.09
44 0.1
45 0.13
46 0.14
47 0.15
48 0.23
49 0.29
50 0.34
51 0.39
52 0.39
53 0.45
54 0.52
55 0.57
56 0.58
57 0.58
58 0.57
59 0.58
60 0.6
61 0.52
62 0.47
63 0.4
64 0.34
65 0.32
66 0.29
67 0.25
68 0.29
69 0.36
70 0.4
71 0.42
72 0.44
73 0.45
74 0.5
75 0.53
76 0.53
77 0.54
78 0.5
79 0.5
80 0.48
81 0.43
82 0.36
83 0.3
84 0.24
85 0.2
86 0.25
87 0.21
88 0.23
89 0.23
90 0.26
91 0.27
92 0.26
93 0.21
94 0.16
95 0.17
96 0.17
97 0.17
98 0.13
99 0.14
100 0.16
101 0.21
102 0.22
103 0.24
104 0.29
105 0.35
106 0.42
107 0.44
108 0.41
109 0.37
110 0.34
111 0.34
112 0.26
113 0.2
114 0.14
115 0.1
116 0.1
117 0.09
118 0.08
119 0.06
120 0.06
121 0.04
122 0.04
123 0.09
124 0.09
125 0.11
126 0.13
127 0.14
128 0.18
129 0.2
130 0.26
131 0.24
132 0.29
133 0.34
134 0.42
135 0.43
136 0.41
137 0.39
138 0.33
139 0.3
140 0.25
141 0.18
142 0.09
143 0.06
144 0.05
145 0.06
146 0.09
147 0.1
148 0.13
149 0.15
150 0.2
151 0.23
152 0.24
153 0.27
154 0.26
155 0.3
156 0.34
157 0.39
158 0.4
159 0.47
160 0.49
161 0.47
162 0.48
163 0.45
164 0.41
165 0.41
166 0.38
167 0.35
168 0.36
169 0.35
170 0.33
171 0.31
172 0.29
173 0.2
174 0.17
175 0.1
176 0.05
177 0.04
178 0.07
179 0.07
180 0.07
181 0.08
182 0.08
183 0.08
184 0.08
185 0.09
186 0.07
187 0.08
188 0.1
189 0.1
190 0.11
191 0.11
192 0.11
193 0.11
194 0.11
195 0.11
196 0.12
197 0.11
198 0.11
199 0.11
200 0.11
201 0.1
202 0.1
203 0.11
204 0.09
205 0.1
206 0.11
207 0.11
208 0.12
209 0.14
210 0.14
211 0.15
212 0.15
213 0.16
214 0.21
215 0.21
216 0.2
217 0.17
218 0.16
219 0.13
220 0.12
221 0.1
222 0.04
223 0.03
224 0.03
225 0.04
226 0.04
227 0.07
228 0.12
229 0.12
230 0.13
231 0.19
232 0.24
233 0.26
234 0.31
235 0.33
236 0.32
237 0.37
238 0.43
239 0.42
240 0.4
241 0.39
242 0.35
243 0.32
244 0.33
245 0.3
246 0.25
247 0.23
248 0.21
249 0.21
250 0.2
251 0.19
252 0.15
253 0.12
254 0.17
255 0.16
256 0.17
257 0.16
258 0.15
259 0.15
260 0.2
261 0.21
262 0.22
263 0.26
264 0.31
265 0.33
266 0.33
267 0.34
268 0.34
269 0.38
270 0.36
271 0.32
272 0.27
273 0.25
274 0.25
275 0.24
276 0.2
277 0.15
278 0.09
279 0.1
280 0.08
281 0.1
282 0.11
283 0.12
284 0.13
285 0.12
286 0.15
287 0.16
288 0.22
289 0.22
290 0.22
291 0.22
292 0.28
293 0.3
294 0.28
295 0.26
296 0.2
297 0.2
298 0.18
299 0.16
300 0.1
301 0.08
302 0.08
303 0.08
304 0.1
305 0.12
306 0.11
307 0.13
308 0.16
309 0.19
310 0.2
311 0.25
312 0.27
313 0.25
314 0.26
315 0.27
316 0.29
317 0.27
318 0.26
319 0.25
320 0.2
321 0.19
322 0.18
323 0.17
324 0.12
325 0.12
326 0.11
327 0.06
328 0.06
329 0.05
330 0.05
331 0.03
332 0.03
333 0.02
334 0.02
335 0.03
336 0.03
337 0.03
338 0.03
339 0.04
340 0.06
341 0.06
342 0.07
343 0.07
344 0.09
345 0.11
346 0.12
347 0.11
348 0.11
349 0.11
350 0.12
351 0.16
352 0.14
353 0.15
354 0.17
355 0.18
356 0.22
357 0.22
358 0.24
359 0.25
360 0.27
361 0.31
362 0.33
363 0.34
364 0.29
365 0.31
366 0.3
367 0.29
368 0.3
369 0.28
370 0.29
371 0.29
372 0.31
373 0.29
374 0.29
375 0.3
376 0.36
377 0.4
378 0.38
379 0.41
380 0.41
381 0.46
382 0.5
383 0.51
384 0.51
385 0.5
386 0.56
387 0.59
388 0.65
389 0.62
390 0.63
391 0.55
392 0.49
393 0.42
394 0.33
395 0.3
396 0.25
397 0.26
398 0.21
399 0.24
400 0.24
401 0.23
402 0.23
403 0.22
404 0.19
405 0.18
406 0.18
407 0.17
408 0.17
409 0.18
410 0.16
411 0.14
412 0.12
413 0.12
414 0.09
415 0.1
416 0.11
417 0.1
418 0.11
419 0.13
420 0.15
421 0.16
422 0.22
423 0.21
424 0.2
425 0.19
426 0.19
427 0.18
428 0.17
429 0.16
430 0.11
431 0.09