Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A401GR47

Protein Details
Accession A0A401GR47   
Localization Confidence Low
Confidence Score 7
NoLS Segment(s)
PositionSequenceProtein Nature
71-91ASKFNHTNKRKCRNILRSFKSHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 8, cyto 7.5, nucl 6, cyto_mito 5.5, mito 2.5
Family & Domain DBs
Amino Acid Sequences MHPLTAFGFPDSPNLLWHVFGALQFEPSLKPRVGPLRVHVNEAWDACFSQNSSFIFCDACNSASHLRHSIASKFNHTNKRKCRNILRSFKSIGASAFPVKLQTRGLDPVAWIYEVLNVQLGPCLVLRTT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.18
3 0.17
4 0.17
5 0.15
6 0.12
7 0.12
8 0.15
9 0.12
10 0.12
11 0.12
12 0.12
13 0.12
14 0.14
15 0.18
16 0.14
17 0.15
18 0.19
19 0.27
20 0.31
21 0.32
22 0.34
23 0.41
24 0.42
25 0.45
26 0.4
27 0.34
28 0.32
29 0.31
30 0.27
31 0.16
32 0.16
33 0.12
34 0.13
35 0.11
36 0.09
37 0.12
38 0.11
39 0.13
40 0.13
41 0.13
42 0.13
43 0.12
44 0.13
45 0.1
46 0.11
47 0.09
48 0.11
49 0.15
50 0.16
51 0.17
52 0.17
53 0.16
54 0.18
55 0.19
56 0.2
57 0.22
58 0.23
59 0.27
60 0.31
61 0.38
62 0.46
63 0.5
64 0.56
65 0.61
66 0.69
67 0.71
68 0.72
69 0.76
70 0.76
71 0.81
72 0.82
73 0.78
74 0.73
75 0.69
76 0.64
77 0.55
78 0.45
79 0.35
80 0.26
81 0.23
82 0.19
83 0.17
84 0.14
85 0.17
86 0.16
87 0.18
88 0.17
89 0.16
90 0.18
91 0.21
92 0.22
93 0.19
94 0.19
95 0.2
96 0.2
97 0.19
98 0.15
99 0.12
100 0.14
101 0.13
102 0.13
103 0.11
104 0.1
105 0.1
106 0.11
107 0.11
108 0.09
109 0.09