Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A401GJZ8

Protein Details
Accession A0A401GJZ8    Localization Confidence Medium Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
108-137ADQATTAKKRKRREKEKERKKRKLAETVEPBasic
NLS Segment(s)
PositionSequence
115-130KKRKRREKEKERKKRK
Subcellular Location(s) cyto_nucl 10.833, cyto 10, nucl 9.5, mito_nucl 9.166, mito 7.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR032704  Cms1  
Pfam View protein in Pfam  
PF14617  CMS1  
Amino Acid Sequences METGNLAKISQQLAGVLASPRALSFSPSPTGPGYTSLRYIDPFLLHLYFLLTTATMSRQRGDDLDDDFVPDDLVAMSEDEDLTPDGDDISGLLSAEEEGEGAAAQEGADQATTAKKRKRREKEKERKKRKLAETVEPIEPPSMAAQPPVLLADYMSSMQAKTFSKMSGVELADIQIPEISIADTTPWTGSRNLDQLVDFIAKMVPTLRTRLSQRPKFSGSPTLIFVAGAALRVADIVRVLKDKRLRGDKGGEIAKLFARHIKVEDQVAYLRRTKVAAAVGTPGRLGKLLCDTDALSTSALTHIILDMSYRDAKKRCVLDIPETRDEQGKIRLVLL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.15
3 0.13
4 0.12
5 0.11
6 0.11
7 0.1
8 0.12
9 0.12
10 0.14
11 0.16
12 0.2
13 0.22
14 0.22
15 0.25
16 0.24
17 0.26
18 0.23
19 0.25
20 0.25
21 0.25
22 0.27
23 0.27
24 0.27
25 0.25
26 0.27
27 0.24
28 0.21
29 0.2
30 0.2
31 0.18
32 0.16
33 0.15
34 0.14
35 0.12
36 0.11
37 0.1
38 0.07
39 0.07
40 0.08
41 0.12
42 0.16
43 0.17
44 0.18
45 0.19
46 0.2
47 0.21
48 0.23
49 0.22
50 0.2
51 0.23
52 0.21
53 0.21
54 0.2
55 0.19
56 0.15
57 0.11
58 0.09
59 0.05
60 0.06
61 0.05
62 0.05
63 0.06
64 0.06
65 0.06
66 0.06
67 0.07
68 0.07
69 0.07
70 0.06
71 0.06
72 0.06
73 0.05
74 0.05
75 0.04
76 0.05
77 0.04
78 0.04
79 0.04
80 0.04
81 0.04
82 0.04
83 0.04
84 0.03
85 0.03
86 0.03
87 0.03
88 0.03
89 0.03
90 0.03
91 0.03
92 0.03
93 0.04
94 0.04
95 0.04
96 0.04
97 0.04
98 0.09
99 0.13
100 0.2
101 0.26
102 0.32
103 0.42
104 0.53
105 0.64
106 0.7
107 0.78
108 0.83
109 0.89
110 0.94
111 0.96
112 0.96
113 0.96
114 0.94
115 0.92
116 0.88
117 0.87
118 0.81
119 0.79
120 0.76
121 0.69
122 0.62
123 0.52
124 0.44
125 0.34
126 0.28
127 0.19
128 0.12
129 0.1
130 0.08
131 0.08
132 0.07
133 0.07
134 0.08
135 0.07
136 0.06
137 0.05
138 0.04
139 0.05
140 0.05
141 0.05
142 0.05
143 0.05
144 0.05
145 0.05
146 0.09
147 0.09
148 0.1
149 0.1
150 0.1
151 0.11
152 0.12
153 0.13
154 0.14
155 0.14
156 0.13
157 0.12
158 0.12
159 0.12
160 0.11
161 0.1
162 0.05
163 0.05
164 0.05
165 0.05
166 0.04
167 0.03
168 0.03
169 0.04
170 0.04
171 0.04
172 0.05
173 0.05
174 0.07
175 0.08
176 0.09
177 0.12
178 0.14
179 0.15
180 0.15
181 0.15
182 0.13
183 0.14
184 0.14
185 0.11
186 0.08
187 0.08
188 0.07
189 0.07
190 0.08
191 0.1
192 0.1
193 0.13
194 0.14
195 0.18
196 0.23
197 0.33
198 0.43
199 0.46
200 0.5
201 0.53
202 0.57
203 0.55
204 0.54
205 0.52
206 0.44
207 0.39
208 0.36
209 0.31
210 0.26
211 0.23
212 0.2
213 0.13
214 0.1
215 0.08
216 0.06
217 0.04
218 0.04
219 0.05
220 0.05
221 0.03
222 0.04
223 0.05
224 0.07
225 0.11
226 0.12
227 0.17
228 0.24
229 0.28
230 0.35
231 0.43
232 0.45
233 0.47
234 0.52
235 0.5
236 0.51
237 0.49
238 0.42
239 0.34
240 0.32
241 0.29
242 0.24
243 0.22
244 0.19
245 0.18
246 0.19
247 0.21
248 0.23
249 0.23
250 0.25
251 0.25
252 0.23
253 0.25
254 0.27
255 0.27
256 0.29
257 0.28
258 0.25
259 0.25
260 0.23
261 0.23
262 0.25
263 0.23
264 0.19
265 0.23
266 0.23
267 0.23
268 0.23
269 0.19
270 0.15
271 0.15
272 0.14
273 0.1
274 0.17
275 0.18
276 0.18
277 0.19
278 0.19
279 0.2
280 0.22
281 0.2
282 0.13
283 0.12
284 0.12
285 0.11
286 0.11
287 0.09
288 0.07
289 0.07
290 0.07
291 0.07
292 0.07
293 0.07
294 0.11
295 0.17
296 0.18
297 0.25
298 0.28
299 0.33
300 0.4
301 0.44
302 0.44
303 0.47
304 0.51
305 0.54
306 0.61
307 0.64
308 0.62
309 0.59
310 0.57
311 0.53
312 0.49
313 0.43
314 0.41
315 0.39