Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q6U7W4

Protein Details
Accession Q6U7W4    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
1-22MRSKQPKEAKQWKESKHCFFRIHydrophilic
NLS Segment(s)
PositionSequence
60-81AGSSRVRSKREGRLRAGSISSR
Subcellular Location(s) mito 6golg 6, extr 4, cyto_mito 4, plas 3, E.R. 3, mito_nucl 3
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
GO:0005739  C:mitochondrion  
Amino Acid Sequences MRSKQPKEAKQWKESKHCFFRISSFLLYLLPCLFFFFSLLLSYPHLPLPLLRREGKEEGAGSSRVRSKREGRLRAGSISSRRS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.83
2 0.82
3 0.81
4 0.77
5 0.7
6 0.62
7 0.58
8 0.51
9 0.47
10 0.38
11 0.29
12 0.24
13 0.23
14 0.21
15 0.17
16 0.13
17 0.1
18 0.08
19 0.09
20 0.08
21 0.07
22 0.07
23 0.07
24 0.06
25 0.06
26 0.07
27 0.07
28 0.08
29 0.08
30 0.09
31 0.09
32 0.09
33 0.08
34 0.09
35 0.13
36 0.17
37 0.21
38 0.23
39 0.25
40 0.3
41 0.32
42 0.32
43 0.3
44 0.25
45 0.23
46 0.23
47 0.23
48 0.19
49 0.2
50 0.25
51 0.26
52 0.28
53 0.32
54 0.37
55 0.46
56 0.56
57 0.6
58 0.61
59 0.66
60 0.67
61 0.65
62 0.63
63 0.59