Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A401H6X0

Protein Details
Accession A0A401H6X0    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
74-100ADSSKKKEAKSHKKWYRQNKMNTQFLFHydrophilic
NLS Segment(s)
PositionSequence
79-84KKEAKS
Subcellular Location(s) mito 19, cyto 4, pero 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR012337  RNaseH-like_sf  
IPR036397  RNaseH_sf  
Gene Ontology GO:0003676  F:nucleic acid binding  
CDD cd09276  Rnase_HI_RT_non_LTR  
Amino Acid Sequences MWRRNEPIMLVPPLPAHHSHPRSHRIPPPTLLESVAAHADAGGKRLIPFLKAPWEDCAIRAELAGQVRILNTTADSSKKKEAKSHKKWYRQNKMNTQFLFIYTDGSQLDTEDGTKTGAGLVILYQDCTVAECKYHMGMQAEVYDAELKALTEGAVTAIPITMSRDTPVWTIFFCADNSSAIVTEFLEADERNQVVIRWTPGHHKIDRNEKADQLAKDAADMETAGGEQATWAHMRRAAKESAIEAWRDAWRNDEDNLCNGWFGPANHLTPSL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.26
3 0.26
4 0.32
5 0.37
6 0.43
7 0.5
8 0.57
9 0.58
10 0.64
11 0.65
12 0.62
13 0.63
14 0.61
15 0.6
16 0.54
17 0.51
18 0.44
19 0.38
20 0.31
21 0.27
22 0.23
23 0.15
24 0.12
25 0.1
26 0.13
27 0.12
28 0.13
29 0.11
30 0.11
31 0.12
32 0.16
33 0.17
34 0.15
35 0.16
36 0.18
37 0.27
38 0.28
39 0.29
40 0.29
41 0.33
42 0.31
43 0.3
44 0.29
45 0.21
46 0.19
47 0.18
48 0.15
49 0.14
50 0.15
51 0.14
52 0.12
53 0.11
54 0.11
55 0.11
56 0.11
57 0.08
58 0.07
59 0.09
60 0.11
61 0.15
62 0.18
63 0.21
64 0.29
65 0.34
66 0.35
67 0.42
68 0.51
69 0.58
70 0.66
71 0.73
72 0.74
73 0.8
74 0.86
75 0.89
76 0.89
77 0.87
78 0.86
79 0.86
80 0.84
81 0.82
82 0.74
83 0.66
84 0.55
85 0.47
86 0.4
87 0.29
88 0.24
89 0.16
90 0.17
91 0.13
92 0.13
93 0.12
94 0.09
95 0.1
96 0.07
97 0.07
98 0.06
99 0.07
100 0.06
101 0.06
102 0.05
103 0.05
104 0.05
105 0.05
106 0.04
107 0.04
108 0.06
109 0.06
110 0.06
111 0.06
112 0.06
113 0.06
114 0.07
115 0.08
116 0.05
117 0.06
118 0.06
119 0.07
120 0.07
121 0.08
122 0.09
123 0.09
124 0.1
125 0.1
126 0.1
127 0.1
128 0.09
129 0.09
130 0.08
131 0.06
132 0.06
133 0.05
134 0.04
135 0.04
136 0.04
137 0.04
138 0.03
139 0.03
140 0.04
141 0.03
142 0.03
143 0.03
144 0.03
145 0.03
146 0.04
147 0.06
148 0.06
149 0.07
150 0.08
151 0.08
152 0.1
153 0.11
154 0.12
155 0.1
156 0.09
157 0.11
158 0.11
159 0.11
160 0.11
161 0.11
162 0.11
163 0.1
164 0.11
165 0.09
166 0.09
167 0.08
168 0.08
169 0.06
170 0.06
171 0.06
172 0.06
173 0.06
174 0.06
175 0.07
176 0.1
177 0.09
178 0.09
179 0.1
180 0.1
181 0.11
182 0.14
183 0.16
184 0.16
185 0.17
186 0.24
187 0.31
188 0.37
189 0.39
190 0.43
191 0.47
192 0.56
193 0.62
194 0.59
195 0.55
196 0.5
197 0.51
198 0.5
199 0.44
200 0.37
201 0.32
202 0.28
203 0.25
204 0.25
205 0.19
206 0.14
207 0.13
208 0.09
209 0.06
210 0.06
211 0.06
212 0.04
213 0.04
214 0.04
215 0.04
216 0.06
217 0.07
218 0.09
219 0.11
220 0.15
221 0.18
222 0.22
223 0.26
224 0.27
225 0.28
226 0.29
227 0.29
228 0.32
229 0.32
230 0.28
231 0.24
232 0.26
233 0.28
234 0.29
235 0.27
236 0.25
237 0.28
238 0.3
239 0.32
240 0.35
241 0.32
242 0.33
243 0.35
244 0.31
245 0.26
246 0.24
247 0.23
248 0.2
249 0.19
250 0.22
251 0.24
252 0.26