Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A401G8V6

Protein Details
Accession A0A401G8V6    Localization Confidence Medium Confidence Score 11.4
NoLS Segment(s)
PositionSequenceProtein Nature
21-52SKTRSAPKTRSAPKTRPAKQPPPKTNRPSIPWHydrophilic
NLS Segment(s)
PositionSequence
19-47PASKTRSAPKTRSAPKTRPAKQPPPKTNR
Subcellular Location(s) nucl 16.5, mito_nucl 13.333, cyto_nucl 10.166, mito 8
Family & Domain DBs
Amino Acid Sequences MSFTPTTKCSARPASKTSPASKTRSAPKTRSAPKTRPAKQPPPKTNRPSIPWVDPPNRNRRDLVIPFKPNVERYSMQRLREIVVLPPFDTLPRILIPSPNSELKPPVMHCGWVVNQSKLFQYAKDRNLPILCNSRTHMKDTDESEEALTARDLNPEEDLVGYYVLLQTTVQLVVEDLKLPWASGLLSITSPLNADGPVILSLFTNYDLARAPSPKSVETLRLWLEQPEQPKWYLDEMNYKWRLGDGRRW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.61
2 0.67
3 0.71
4 0.7
5 0.69
6 0.67
7 0.67
8 0.66
9 0.64
10 0.65
11 0.68
12 0.7
13 0.65
14 0.68
15 0.72
16 0.75
17 0.78
18 0.77
19 0.75
20 0.75
21 0.81
22 0.81
23 0.81
24 0.81
25 0.82
26 0.83
27 0.87
28 0.89
29 0.87
30 0.89
31 0.86
32 0.86
33 0.82
34 0.77
35 0.74
36 0.69
37 0.66
38 0.64
39 0.65
40 0.63
41 0.63
42 0.66
43 0.68
44 0.67
45 0.63
46 0.56
47 0.52
48 0.54
49 0.53
50 0.54
51 0.53
52 0.52
53 0.51
54 0.53
55 0.51
56 0.45
57 0.38
58 0.35
59 0.28
60 0.29
61 0.39
62 0.4
63 0.39
64 0.4
65 0.39
66 0.35
67 0.35
68 0.31
69 0.24
70 0.23
71 0.22
72 0.19
73 0.19
74 0.17
75 0.15
76 0.15
77 0.11
78 0.09
79 0.09
80 0.1
81 0.1
82 0.13
83 0.14
84 0.17
85 0.2
86 0.21
87 0.21
88 0.21
89 0.22
90 0.2
91 0.22
92 0.19
93 0.2
94 0.17
95 0.17
96 0.16
97 0.17
98 0.17
99 0.21
100 0.22
101 0.19
102 0.2
103 0.2
104 0.2
105 0.21
106 0.21
107 0.14
108 0.2
109 0.26
110 0.29
111 0.33
112 0.33
113 0.33
114 0.34
115 0.33
116 0.29
117 0.3
118 0.27
119 0.24
120 0.24
121 0.29
122 0.29
123 0.31
124 0.31
125 0.25
126 0.28
127 0.29
128 0.32
129 0.26
130 0.25
131 0.22
132 0.19
133 0.17
134 0.13
135 0.11
136 0.07
137 0.06
138 0.08
139 0.09
140 0.09
141 0.09
142 0.09
143 0.09
144 0.09
145 0.09
146 0.07
147 0.06
148 0.05
149 0.05
150 0.05
151 0.05
152 0.05
153 0.04
154 0.04
155 0.05
156 0.05
157 0.05
158 0.05
159 0.05
160 0.06
161 0.07
162 0.07
163 0.06
164 0.08
165 0.08
166 0.08
167 0.08
168 0.07
169 0.07
170 0.07
171 0.08
172 0.07
173 0.07
174 0.08
175 0.08
176 0.08
177 0.08
178 0.07
179 0.07
180 0.06
181 0.07
182 0.06
183 0.07
184 0.07
185 0.07
186 0.07
187 0.06
188 0.07
189 0.08
190 0.08
191 0.08
192 0.08
193 0.09
194 0.1
195 0.12
196 0.15
197 0.17
198 0.18
199 0.22
200 0.25
201 0.25
202 0.27
203 0.28
204 0.3
205 0.3
206 0.34
207 0.32
208 0.32
209 0.32
210 0.31
211 0.33
212 0.31
213 0.34
214 0.33
215 0.33
216 0.31
217 0.32
218 0.32
219 0.33
220 0.33
221 0.31
222 0.36
223 0.38
224 0.47
225 0.47
226 0.45
227 0.4
228 0.39
229 0.42