Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A401G719

Protein Details
Accession A0A401G719   
Localization Confidence Low
Confidence Score 9.5
NoLS Segment(s)
PositionSequenceProtein Nature
103-128GKLTRPTSVRHTKLKSKKKKGLCLVCHydrophilic
NLS Segment(s)
PositionSequence
101-122PKGKLTRPTSVRHTKLKSKKKK
Subcellular Location(s) cyto 18.5, cyto_nucl 15.333, nucl 7, mito_nucl 5.165
Family & Domain DBs
Amino Acid Sequences MEISGPVDIVVHEPEDKLEPTVHIDIIECASSASSSIRIQDNEARPADGAVNGTADNLEAAVQPTVPSMPSPAHPPGPLPVEYVLGSAEPVDVFMPEAFRPKGKLTRPTSVRHTKLKSKKKKGLCLVC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.14
3 0.15
4 0.15
5 0.14
6 0.14
7 0.18
8 0.2
9 0.19
10 0.16
11 0.15
12 0.15
13 0.15
14 0.14
15 0.09
16 0.07
17 0.07
18 0.07
19 0.07
20 0.07
21 0.08
22 0.08
23 0.11
24 0.14
25 0.14
26 0.17
27 0.24
28 0.27
29 0.3
30 0.3
31 0.28
32 0.25
33 0.25
34 0.23
35 0.16
36 0.13
37 0.08
38 0.08
39 0.07
40 0.07
41 0.06
42 0.05
43 0.05
44 0.04
45 0.04
46 0.03
47 0.04
48 0.04
49 0.04
50 0.04
51 0.04
52 0.05
53 0.04
54 0.04
55 0.05
56 0.06
57 0.07
58 0.11
59 0.13
60 0.15
61 0.15
62 0.16
63 0.17
64 0.2
65 0.19
66 0.16
67 0.15
68 0.15
69 0.15
70 0.14
71 0.12
72 0.08
73 0.08
74 0.06
75 0.06
76 0.04
77 0.04
78 0.04
79 0.04
80 0.05
81 0.06
82 0.07
83 0.08
84 0.13
85 0.14
86 0.15
87 0.18
88 0.22
89 0.3
90 0.35
91 0.44
92 0.46
93 0.55
94 0.59
95 0.62
96 0.67
97 0.69
98 0.69
99 0.68
100 0.69
101 0.7
102 0.76
103 0.81
104 0.82
105 0.83
106 0.87
107 0.87
108 0.9