Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E2M479

Protein Details
Accession E2M479    Localization Confidence Medium Confidence Score 10.7
NoLS Segment(s)
PositionSequenceProtein Nature
2-29EAVLERQRQARKEKRQRKEKERGLATRABasic
NLS Segment(s)
PositionSequence
9-24RQARKEKRQRKEKERG
Subcellular Location(s) mito 15, nucl 9, cyto_mito 9
Family & Domain DBs
KEGG mpr:MPER_15104  -  
Amino Acid Sequences MEAVLERQRQARKEKRQRKEKERGLATRASQSSPTPAGASGRGSGTEPPLVKREDQSNDADVEQVSSMTGSEVSRRVNICGVQVVMNPKQPPPLTPSQAKYYREHTINQGLT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.78
2 0.82
3 0.87
4 0.92
5 0.92
6 0.93
7 0.91
8 0.89
9 0.88
10 0.83
11 0.77
12 0.72
13 0.63
14 0.6
15 0.52
16 0.43
17 0.35
18 0.3
19 0.29
20 0.25
21 0.24
22 0.16
23 0.15
24 0.15
25 0.15
26 0.15
27 0.12
28 0.11
29 0.11
30 0.11
31 0.11
32 0.11
33 0.14
34 0.13
35 0.14
36 0.16
37 0.17
38 0.17
39 0.18
40 0.22
41 0.21
42 0.23
43 0.24
44 0.22
45 0.22
46 0.21
47 0.2
48 0.14
49 0.12
50 0.09
51 0.07
52 0.05
53 0.04
54 0.04
55 0.04
56 0.05
57 0.04
58 0.06
59 0.09
60 0.1
61 0.13
62 0.14
63 0.15
64 0.17
65 0.18
66 0.17
67 0.17
68 0.17
69 0.14
70 0.16
71 0.2
72 0.2
73 0.24
74 0.24
75 0.23
76 0.29
77 0.28
78 0.28
79 0.3
80 0.37
81 0.38
82 0.44
83 0.47
84 0.5
85 0.57
86 0.59
87 0.55
88 0.52
89 0.55
90 0.51
91 0.49
92 0.47