Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A401GJY3

Protein Details
Accession A0A401GJY3    Localization Confidence Medium Confidence Score 11.2
NoLS Segment(s)
PositionSequenceProtein Nature
41-64REELAKIRARKREKKAEREREISSBasic
NLS Segment(s)
PositionSequence
46-59KIRARKREKKAERE
Subcellular Location(s) nucl 11, cyto_nucl 10.5, cyto 8, pero 3, mito 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR018625  Pet100  
Gene Ontology GO:0005739  C:mitochondrion  
GO:0033617  P:mitochondrial cytochrome c oxidase assembly  
Pfam View protein in Pfam  
PF09803  Pet100  
Amino Acid Sequences MMLHYGDPDWYNRHVLSYKDHIFPPDERLVTKLPADQSALREELAKIRARKREKKAEREREISSAAAHTA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.25
3 0.28
4 0.33
5 0.35
6 0.34
7 0.35
8 0.33
9 0.33
10 0.33
11 0.33
12 0.3
13 0.26
14 0.23
15 0.25
16 0.25
17 0.23
18 0.23
19 0.19
20 0.15
21 0.15
22 0.17
23 0.15
24 0.15
25 0.16
26 0.16
27 0.14
28 0.14
29 0.13
30 0.15
31 0.18
32 0.22
33 0.24
34 0.3
35 0.39
36 0.48
37 0.57
38 0.63
39 0.71
40 0.75
41 0.81
42 0.86
43 0.89
44 0.88
45 0.84
46 0.78
47 0.71
48 0.63
49 0.53
50 0.43