Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A401GYI5

Protein Details
Accession A0A401GYI5   
Localization Confidence Medium
Confidence Score 13.9
NoLS Segment(s)
PositionSequenceProtein Nature
4-37ESTKSSKRKAVDKAEKAPKAKAKRDPKAPKRALSHydrophilic
NLS Segment(s)
PositionSequence
7-34KSSKRKAVDKAEKAPKAKAKRDPKAPKR
Subcellular Location(s) nucl 22.5, cyto_nucl 13, cyto 2.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR009071  HMG_box_dom  
IPR036910  HMG_box_dom_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
Pfam View protein in Pfam  
PF00505  HMG_box  
PROSITE View protein in PROSITE  
PS50118  HMG_BOX_2  
CDD cd01390  HMG-box_NHP6-like  
Amino Acid Sequences MPKESTKSSKRKAVDKAEKAPKAKAKRDPKAPKRALSAYMFFSQDWRERIKAENPDAGFGEIGKLLGAKWKELDDSEKKPYIEQAARDKARAEQEKSEYDNKKADSAGSGDGGDEDDE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.78
2 0.76
3 0.79
4 0.8
5 0.81
6 0.75
7 0.74
8 0.71
9 0.69
10 0.69
11 0.69
12 0.69
13 0.71
14 0.8
15 0.84
16 0.85
17 0.87
18 0.85
19 0.8
20 0.76
21 0.7
22 0.64
23 0.56
24 0.49
25 0.41
26 0.37
27 0.33
28 0.26
29 0.24
30 0.22
31 0.22
32 0.21
33 0.21
34 0.19
35 0.2
36 0.23
37 0.28
38 0.32
39 0.31
40 0.33
41 0.3
42 0.3
43 0.3
44 0.26
45 0.2
46 0.13
47 0.11
48 0.06
49 0.06
50 0.04
51 0.04
52 0.03
53 0.08
54 0.08
55 0.08
56 0.09
57 0.1
58 0.11
59 0.12
60 0.18
61 0.2
62 0.25
63 0.3
64 0.33
65 0.33
66 0.32
67 0.34
68 0.35
69 0.32
70 0.33
71 0.37
72 0.42
73 0.43
74 0.44
75 0.43
76 0.39
77 0.45
78 0.47
79 0.42
80 0.39
81 0.43
82 0.47
83 0.51
84 0.56
85 0.5
86 0.47
87 0.49
88 0.44
89 0.41
90 0.37
91 0.33
92 0.26
93 0.25
94 0.24
95 0.19
96 0.18
97 0.15
98 0.15