Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A401GXP6

Protein Details
Accession A0A401GXP6    Localization Confidence High Confidence Score 15.1
NoLS Segment(s)
PositionSequenceProtein Nature
202-229VEPVKKESKAERKERKEREKAEKKKLAMBasic
NLS Segment(s)
PositionSequence
87-101RNGGKKGAKGKANGE
106-115TTKKGKKRKA
128-141PKKKKSATKVTKGR
206-227KKESKAERKERKEREKAEKKKL
Subcellular Location(s) nucl 10.5, cyto_nucl 8.5, cyto 5.5, pero 5, mito 2, plas 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR013243  SCA7_dom  
IPR037804  SGF73  
Gene Ontology GO:0000124  C:SAGA complex  
Pfam View protein in Pfam  
PF08313  SCA7  
PROSITE View protein in PROSITE  
PS51505  SCA7  
Amino Acid Sequences MTIKLKPSHSPDPPPFSWDDVPSTPPPPADISSPPSPPTSWLSARDMKMFGAEPLREEIGLVKCIDCGKPVLRSAILEHAENCAKIRNGGKKGAKGKANGEADTDTTKKGKKRKAEDEDPTPDDPSLPKKKKSATKVTKGRFKGPVDYDKQCGVINDKGLPCSRSLTCKSHSMGAKRAVQGRSKPYDELLLEWNRLNNPNWVEPVKKESKAERKERKEREKAEKKKLAMEAAAAAGIELSKKALNTVLGTSGTKKGKKAAVAAAAAAAAAAVAASTMGPGEDVYENLDDIDSEGEVDSLVHAVRFAQNRGVTSVPLAVPCDAGSWFVGRRERLRSCQQLLSQALVSKSASSTSTVTVGGRL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.63
2 0.58
3 0.54
4 0.51
5 0.43
6 0.41
7 0.34
8 0.38
9 0.37
10 0.37
11 0.32
12 0.29
13 0.28
14 0.26
15 0.25
16 0.24
17 0.25
18 0.3
19 0.33
20 0.36
21 0.35
22 0.34
23 0.32
24 0.31
25 0.32
26 0.32
27 0.31
28 0.33
29 0.38
30 0.43
31 0.45
32 0.45
33 0.41
34 0.35
35 0.33
36 0.29
37 0.25
38 0.24
39 0.22
40 0.2
41 0.22
42 0.23
43 0.2
44 0.19
45 0.21
46 0.18
47 0.2
48 0.19
49 0.16
50 0.17
51 0.19
52 0.2
53 0.16
54 0.17
55 0.18
56 0.22
57 0.24
58 0.26
59 0.24
60 0.25
61 0.26
62 0.3
63 0.29
64 0.25
65 0.23
66 0.24
67 0.25
68 0.24
69 0.22
70 0.18
71 0.17
72 0.2
73 0.27
74 0.31
75 0.35
76 0.44
77 0.48
78 0.52
79 0.59
80 0.62
81 0.6
82 0.55
83 0.53
84 0.53
85 0.51
86 0.43
87 0.38
88 0.32
89 0.29
90 0.29
91 0.26
92 0.19
93 0.19
94 0.23
95 0.26
96 0.34
97 0.4
98 0.46
99 0.54
100 0.64
101 0.7
102 0.76
103 0.77
104 0.77
105 0.77
106 0.72
107 0.63
108 0.53
109 0.43
110 0.34
111 0.28
112 0.29
113 0.33
114 0.34
115 0.37
116 0.41
117 0.49
118 0.56
119 0.63
120 0.66
121 0.65
122 0.7
123 0.76
124 0.79
125 0.8
126 0.75
127 0.72
128 0.68
129 0.6
130 0.57
131 0.52
132 0.53
133 0.5
134 0.49
135 0.45
136 0.39
137 0.38
138 0.3
139 0.26
140 0.22
141 0.18
142 0.17
143 0.19
144 0.18
145 0.19
146 0.2
147 0.2
148 0.17
149 0.18
150 0.18
151 0.19
152 0.24
153 0.26
154 0.27
155 0.32
156 0.32
157 0.34
158 0.37
159 0.34
160 0.35
161 0.37
162 0.39
163 0.36
164 0.41
165 0.38
166 0.38
167 0.39
168 0.4
169 0.39
170 0.36
171 0.34
172 0.28
173 0.29
174 0.26
175 0.23
176 0.22
177 0.19
178 0.19
179 0.18
180 0.19
181 0.17
182 0.19
183 0.19
184 0.18
185 0.18
186 0.19
187 0.21
188 0.22
189 0.22
190 0.21
191 0.27
192 0.27
193 0.27
194 0.28
195 0.33
196 0.42
197 0.49
198 0.59
199 0.62
200 0.67
201 0.76
202 0.83
203 0.85
204 0.85
205 0.85
206 0.85
207 0.86
208 0.85
209 0.86
210 0.82
211 0.74
212 0.7
213 0.65
214 0.55
215 0.45
216 0.36
217 0.26
218 0.2
219 0.18
220 0.11
221 0.08
222 0.06
223 0.05
224 0.04
225 0.03
226 0.04
227 0.05
228 0.05
229 0.06
230 0.07
231 0.08
232 0.1
233 0.11
234 0.12
235 0.13
236 0.13
237 0.15
238 0.21
239 0.25
240 0.26
241 0.26
242 0.29
243 0.32
244 0.34
245 0.36
246 0.35
247 0.34
248 0.33
249 0.32
250 0.26
251 0.22
252 0.19
253 0.15
254 0.09
255 0.03
256 0.02
257 0.02
258 0.01
259 0.01
260 0.02
261 0.02
262 0.02
263 0.02
264 0.02
265 0.03
266 0.03
267 0.05
268 0.06
269 0.06
270 0.08
271 0.09
272 0.09
273 0.09
274 0.09
275 0.07
276 0.07
277 0.08
278 0.05
279 0.05
280 0.05
281 0.05
282 0.05
283 0.05
284 0.05
285 0.05
286 0.05
287 0.05
288 0.05
289 0.06
290 0.12
291 0.15
292 0.16
293 0.22
294 0.24
295 0.25
296 0.29
297 0.29
298 0.24
299 0.22
300 0.24
301 0.19
302 0.18
303 0.18
304 0.15
305 0.15
306 0.14
307 0.14
308 0.11
309 0.11
310 0.11
311 0.12
312 0.14
313 0.19
314 0.24
315 0.27
316 0.32
317 0.4
318 0.45
319 0.51
320 0.58
321 0.62
322 0.62
323 0.66
324 0.64
325 0.63
326 0.59
327 0.54
328 0.47
329 0.41
330 0.36
331 0.31
332 0.28
333 0.21
334 0.19
335 0.17
336 0.16
337 0.15
338 0.16
339 0.16
340 0.18
341 0.18