Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A401GBN2

Protein Details
Accession A0A401GBN2    Localization Confidence Medium Confidence Score 13.8
NoLS Segment(s)
PositionSequenceProtein Nature
82-122LDLRVKKTRAIRRRLTKHEASLKTLKQRKKDINFPIRKYAVHydrophilic
NLS Segment(s)
PositionSequence
85-112RVKKTRAIRRRLTKHEASLKTLKQRKKD
Subcellular Location(s) nucl 21.5, cyto_nucl 12.5, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR001854  Ribosomal_L29/L35  
IPR036049  Ribosomal_L29/L35_sf  
IPR018254  Ribosomal_L29_CS  
IPR045059  RL35  
Gene Ontology GO:0022625  C:cytosolic large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0000463  P:maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00831  Ribosomal_L29  
PROSITE View protein in PROSITE  
PS00579  RIBOSOMAL_L29  
CDD cd00427  Ribosomal_L29_HIP  
Amino Acid Sequences MPGKVKAYELQSKSKNDLTKQLVELKNELLALRVQKIAGGSAAKLTKINTVRKSIARVLTVTNQKQRQNLREFYKNKKYLPLDLRVKKTRAIRRRLTKHEASLKTLKQRKKDINFPIRKYAVKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.56
2 0.55
3 0.48
4 0.53
5 0.5
6 0.49
7 0.48
8 0.53
9 0.5
10 0.47
11 0.46
12 0.37
13 0.33
14 0.28
15 0.24
16 0.16
17 0.15
18 0.14
19 0.14
20 0.14
21 0.12
22 0.12
23 0.13
24 0.12
25 0.11
26 0.1
27 0.08
28 0.11
29 0.12
30 0.12
31 0.12
32 0.12
33 0.17
34 0.22
35 0.29
36 0.29
37 0.33
38 0.36
39 0.37
40 0.41
41 0.39
42 0.36
43 0.3
44 0.27
45 0.25
46 0.28
47 0.32
48 0.31
49 0.34
50 0.36
51 0.37
52 0.42
53 0.45
54 0.46
55 0.46
56 0.5
57 0.49
58 0.54
59 0.56
60 0.59
61 0.65
62 0.62
63 0.57
64 0.58
65 0.55
66 0.54
67 0.54
68 0.55
69 0.54
70 0.56
71 0.63
72 0.61
73 0.6
74 0.57
75 0.61
76 0.62
77 0.61
78 0.63
79 0.65
80 0.7
81 0.78
82 0.82
83 0.81
84 0.77
85 0.77
86 0.78
87 0.71
88 0.67
89 0.66
90 0.62
91 0.64
92 0.66
93 0.63
94 0.61
95 0.68
96 0.72
97 0.73
98 0.77
99 0.77
100 0.81
101 0.85
102 0.82
103 0.82
104 0.76