Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A401GHK9

Protein Details
Accession A0A401GHK9    Localization Confidence High Confidence Score 16.4
NoLS Segment(s)
PositionSequenceProtein Nature
16-59TASSSRKRSRENETPSQRHKREKAAERQRRKRERDRQAGLNNILHydrophilic
NLS Segment(s)
PositionSequence
21-50RKRSRENETPSQRHKREKAAERQRRKRERD
97-121KRDRVRAAARERQRKHRALVKARKL
Subcellular Location(s) nucl 23.5, cyto_nucl 13.5
Family & Domain DBs
Amino Acid Sequences MDMNVHHHDPNNIPPTASSSRKRSRENETPSQRHKREKAAERQRRKRERDRQAGLNNILALSQVQAGAPQVEQPIPDPQSISDVYKGDEFSMEELAKRDRVRAAARERQRKHRALVKARKLRELGLDMGNEILPGMEEVQYRMNADGQYQPVMPHEMPPHQPPHTHPMHEPPFPQGQPLGGQTFASTLLLSFSCAPLLKQHLLRTLNMTNEELASLEPIIAQAWDHWDQQRRMHAFAHHPGNAQKAPDGSAMHDPNAPYQMNDHGVTHPYVHDPSQAPPNDFRARFHRPLVAPSPFRSAIVDPDAQQQQQPGTAPSSSASVSASVGPPGPSAESLDPHLSAGSAQSDQRNGVVGIDPQLGQARDEAAGVAGKLER
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.37
3 0.4
4 0.44
5 0.42
6 0.46
7 0.55
8 0.63
9 0.71
10 0.69
11 0.72
12 0.75
13 0.77
14 0.78
15 0.79
16 0.81
17 0.83
18 0.88
19 0.85
20 0.85
21 0.82
22 0.81
23 0.81
24 0.81
25 0.82
26 0.83
27 0.87
28 0.88
29 0.92
30 0.93
31 0.93
32 0.92
33 0.92
34 0.92
35 0.92
36 0.92
37 0.88
38 0.87
39 0.84
40 0.83
41 0.74
42 0.66
43 0.55
44 0.44
45 0.36
46 0.26
47 0.19
48 0.11
49 0.09
50 0.07
51 0.06
52 0.07
53 0.07
54 0.08
55 0.08
56 0.09
57 0.1
58 0.11
59 0.11
60 0.13
61 0.19
62 0.2
63 0.21
64 0.19
65 0.18
66 0.22
67 0.23
68 0.23
69 0.19
70 0.18
71 0.19
72 0.2
73 0.2
74 0.16
75 0.16
76 0.14
77 0.12
78 0.15
79 0.14
80 0.13
81 0.14
82 0.16
83 0.2
84 0.2
85 0.21
86 0.2
87 0.24
88 0.28
89 0.35
90 0.41
91 0.46
92 0.55
93 0.63
94 0.66
95 0.72
96 0.76
97 0.73
98 0.7
99 0.69
100 0.7
101 0.7
102 0.76
103 0.76
104 0.75
105 0.73
106 0.73
107 0.66
108 0.58
109 0.51
110 0.44
111 0.36
112 0.3
113 0.27
114 0.21
115 0.21
116 0.19
117 0.14
118 0.1
119 0.07
120 0.04
121 0.04
122 0.04
123 0.06
124 0.06
125 0.07
126 0.09
127 0.1
128 0.11
129 0.11
130 0.12
131 0.1
132 0.12
133 0.14
134 0.13
135 0.14
136 0.14
137 0.14
138 0.13
139 0.16
140 0.15
141 0.15
142 0.16
143 0.19
144 0.21
145 0.24
146 0.27
147 0.25
148 0.27
149 0.26
150 0.31
151 0.31
152 0.3
153 0.28
154 0.33
155 0.36
156 0.37
157 0.35
158 0.31
159 0.33
160 0.3
161 0.3
162 0.21
163 0.17
164 0.16
165 0.17
166 0.14
167 0.09
168 0.09
169 0.09
170 0.09
171 0.08
172 0.07
173 0.05
174 0.04
175 0.05
176 0.05
177 0.06
178 0.05
179 0.05
180 0.06
181 0.06
182 0.06
183 0.08
184 0.12
185 0.14
186 0.16
187 0.18
188 0.24
189 0.26
190 0.26
191 0.29
192 0.27
193 0.26
194 0.24
195 0.23
196 0.17
197 0.15
198 0.15
199 0.1
200 0.08
201 0.06
202 0.05
203 0.04
204 0.04
205 0.04
206 0.04
207 0.04
208 0.04
209 0.04
210 0.08
211 0.1
212 0.12
213 0.16
214 0.23
215 0.25
216 0.28
217 0.36
218 0.34
219 0.34
220 0.35
221 0.35
222 0.34
223 0.39
224 0.41
225 0.35
226 0.34
227 0.34
228 0.36
229 0.33
230 0.28
231 0.23
232 0.17
233 0.18
234 0.19
235 0.18
236 0.15
237 0.21
238 0.22
239 0.21
240 0.22
241 0.21
242 0.2
243 0.23
244 0.21
245 0.14
246 0.14
247 0.17
248 0.18
249 0.19
250 0.19
251 0.16
252 0.18
253 0.18
254 0.18
255 0.15
256 0.15
257 0.15
258 0.14
259 0.17
260 0.17
261 0.19
262 0.27
263 0.28
264 0.29
265 0.3
266 0.37
267 0.4
268 0.39
269 0.4
270 0.4
271 0.46
272 0.47
273 0.48
274 0.48
275 0.41
276 0.47
277 0.51
278 0.51
279 0.45
280 0.43
281 0.47
282 0.4
283 0.39
284 0.35
285 0.29
286 0.26
287 0.27
288 0.27
289 0.21
290 0.27
291 0.3
292 0.28
293 0.28
294 0.25
295 0.21
296 0.22
297 0.22
298 0.17
299 0.17
300 0.17
301 0.17
302 0.15
303 0.16
304 0.14
305 0.13
306 0.12
307 0.1
308 0.11
309 0.12
310 0.12
311 0.11
312 0.13
313 0.13
314 0.12
315 0.13
316 0.13
317 0.12
318 0.15
319 0.16
320 0.17
321 0.2
322 0.22
323 0.21
324 0.2
325 0.19
326 0.15
327 0.13
328 0.13
329 0.12
330 0.12
331 0.14
332 0.17
333 0.19
334 0.2
335 0.2
336 0.21
337 0.18
338 0.18
339 0.18
340 0.16
341 0.18
342 0.19
343 0.19
344 0.18
345 0.22
346 0.21
347 0.19
348 0.18
349 0.17
350 0.15
351 0.15
352 0.14
353 0.1
354 0.11
355 0.1