Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A401G912

Protein Details
Accession A0A401G912    Localization Confidence Medium Confidence Score 12.9
NoLS Segment(s)
PositionSequenceProtein Nature
45-64LYRRGRARRSLGRRACRYTRBasic
NLS Segment(s)
PositionSequence
38-57RERSAKALYRRGRARRSLGR
Subcellular Location(s) nucl 18.5, cyto_nucl 11.5, mito 4, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR011990  TPR-like_helical_dom_sf  
Amino Acid Sequences MEWMEPVYTEHWLNRAAAYLRLCAYKHAEQDADEAIRRERSAKALYRRGRARRSLGRRACRYTRSLAT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.18
3 0.17
4 0.2
5 0.2
6 0.19
7 0.19
8 0.21
9 0.21
10 0.19
11 0.24
12 0.23
13 0.24
14 0.24
15 0.24
16 0.22
17 0.23
18 0.22
19 0.17
20 0.14
21 0.13
22 0.12
23 0.12
24 0.11
25 0.12
26 0.11
27 0.15
28 0.2
29 0.26
30 0.34
31 0.42
32 0.48
33 0.55
34 0.63
35 0.67
36 0.69
37 0.68
38 0.69
39 0.7
40 0.73
41 0.76
42 0.77
43 0.79
44 0.79
45 0.81
46 0.79
47 0.74
48 0.7