Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A401GAJ4

Protein Details
Accession A0A401GAJ4    Localization Confidence Medium Confidence Score 12.7
NoLS Segment(s)
PositionSequenceProtein Nature
7-27HTNHNQSKKAHRNGIKKPKSYHydrophilic
NLS Segment(s)
PositionSequence
14-55KKAHRNGIKKPKSYRTRSMKGVDPKFRRNAKFALVGSRKARL
Subcellular Location(s) nucl 23.5, cyto_nucl 13.833, mito_nucl 13.166
Family & Domain DBs
InterPro View protein in InterPro  
IPR002673  Ribosomal_L29e  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01779  Ribosomal_L29e  
Amino Acid Sequences MAKSKNHTNHNQSKKAHRNGIKKPKSYRTRSMKGVDPKFRRNAKFALVGSRKARLEAKEAS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.8
2 0.79
3 0.78
4 0.76
5 0.76
6 0.78
7 0.84
8 0.82
9 0.79
10 0.78
11 0.79
12 0.8
13 0.77
14 0.76
15 0.75
16 0.72
17 0.7
18 0.66
19 0.63
20 0.63
21 0.65
22 0.64
23 0.61
24 0.61
25 0.64
26 0.68
27 0.64
28 0.58
29 0.53
30 0.48
31 0.49
32 0.44
33 0.46
34 0.42
35 0.46
36 0.44
37 0.47
38 0.43
39 0.4
40 0.43
41 0.35