Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A401H392

Protein Details
Accession A0A401H392    Localization Confidence Medium Confidence Score 14.3
NoLS Segment(s)
PositionSequenceProtein Nature
47-74RGTAARRAARRIQRRRRIRLCANPSAISHydrophilic
NLS Segment(s)
PositionSequence
51-64ARRAARRIQRRRRI
Subcellular Location(s) nucl 23, cyto_nucl 13.5
Family & Domain DBs
Amino Acid Sequences MKDLAEIPPRPRTSRGFFRPHDTLTACEVEIHRTPSSSAAACCSSSRGTAARRAARRIQRRRRIRLCANPSAIS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.56
2 0.6
3 0.6
4 0.59
5 0.62
6 0.62
7 0.57
8 0.53
9 0.44
10 0.38
11 0.32
12 0.3
13 0.23
14 0.2
15 0.19
16 0.18
17 0.18
18 0.19
19 0.16
20 0.15
21 0.16
22 0.16
23 0.17
24 0.14
25 0.12
26 0.11
27 0.12
28 0.13
29 0.12
30 0.13
31 0.12
32 0.11
33 0.13
34 0.14
35 0.15
36 0.22
37 0.29
38 0.35
39 0.38
40 0.43
41 0.5
42 0.56
43 0.65
44 0.7
45 0.73
46 0.76
47 0.83
48 0.89
49 0.89
50 0.9
51 0.89
52 0.89
53 0.87
54 0.86