Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A401GGB1

Protein Details
Accession A0A401GGB1    Localization Confidence Medium Confidence Score 10.2
NoLS Segment(s)
PositionSequenceProtein Nature
16-40QSPAGRPRRDVKKMSKSQKNYPDPNHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 19, cyto_nucl 11.5, mito 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR002300  aa-tRNA-synth_Ia  
IPR023586  Ile-tRNA-ligase_type2  
Gene Ontology GO:0005524  F:ATP binding  
GO:0004822  F:isoleucine-tRNA ligase activity  
GO:0006418  P:tRNA aminoacylation for protein translation  
Pfam View protein in Pfam  
PF00133  tRNA-synt_1  
Amino Acid Sequences MVLYSQRGYLDNFRAQSPAGRPRRDVKKMSKSQKNYPDPNDIINLYDADATRMFLVNSPVVRGDNLRFREEGVREVVSRVLPASLAKCNTIFPRASSAA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.3
3 0.32
4 0.32
5 0.36
6 0.39
7 0.4
8 0.43
9 0.51
10 0.61
11 0.63
12 0.65
13 0.65
14 0.68
15 0.75
16 0.81
17 0.82
18 0.78
19 0.8
20 0.82
21 0.81
22 0.77
23 0.71
24 0.69
25 0.6
26 0.56
27 0.48
28 0.38
29 0.3
30 0.23
31 0.19
32 0.11
33 0.11
34 0.09
35 0.08
36 0.08
37 0.07
38 0.07
39 0.07
40 0.07
41 0.07
42 0.09
43 0.09
44 0.09
45 0.1
46 0.1
47 0.1
48 0.11
49 0.12
50 0.13
51 0.19
52 0.21
53 0.23
54 0.22
55 0.24
56 0.29
57 0.28
58 0.28
59 0.24
60 0.23
61 0.21
62 0.22
63 0.22
64 0.17
65 0.16
66 0.14
67 0.1
68 0.09
69 0.11
70 0.13
71 0.16
72 0.18
73 0.19
74 0.19
75 0.23
76 0.26
77 0.29
78 0.28
79 0.24