Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A401H428

Protein Details
Accession A0A401H428    Localization Confidence Low Confidence Score 7.6
NoLS Segment(s)
PositionSequenceProtein Nature
2-27SEIPVQPVARSRKRRYPRGYAYPIPYHydrophilic
NLS Segment(s)
Subcellular Location(s) mito_nucl 12.833, mito 12, nucl 11.5, cyto_nucl 8.166
Family & Domain DBs
Amino Acid Sequences MSEIPVQPVARSRKRRYPRGYAYPIPYSVYAPLAKELGIPNVNTKNVNAYWQFRYRLMEDCNVPNKCFQGVYVDGMSSMAVVFADTYSRERMKADEELVQRVKKFLKTEENPRWYVLD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.72
2 0.81
3 0.82
4 0.83
5 0.83
6 0.84
7 0.84
8 0.8
9 0.77
10 0.7
11 0.63
12 0.54
13 0.45
14 0.35
15 0.28
16 0.24
17 0.19
18 0.16
19 0.16
20 0.14
21 0.13
22 0.13
23 0.13
24 0.14
25 0.15
26 0.14
27 0.17
28 0.2
29 0.21
30 0.2
31 0.19
32 0.19
33 0.18
34 0.21
35 0.2
36 0.2
37 0.24
38 0.28
39 0.29
40 0.26
41 0.28
42 0.26
43 0.28
44 0.27
45 0.25
46 0.23
47 0.25
48 0.32
49 0.3
50 0.29
51 0.26
52 0.24
53 0.22
54 0.2
55 0.16
56 0.13
57 0.13
58 0.15
59 0.15
60 0.14
61 0.13
62 0.13
63 0.13
64 0.07
65 0.06
66 0.03
67 0.03
68 0.03
69 0.03
70 0.03
71 0.04
72 0.05
73 0.07
74 0.12
75 0.13
76 0.13
77 0.14
78 0.16
79 0.19
80 0.22
81 0.23
82 0.26
83 0.27
84 0.34
85 0.38
86 0.4
87 0.36
88 0.36
89 0.37
90 0.35
91 0.37
92 0.37
93 0.43
94 0.47
95 0.58
96 0.65
97 0.68
98 0.65