Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E2LMX3

Protein Details
Accession E2LMX3   
Localization Confidence Medium
Confidence Score 10.6
NoLS Segment(s)
PositionSequenceProtein Nature
74-97TDARGELKQGKKRKRQTSAEGDEIHydrophilic
NLS Segment(s)
PositionSequence
83-87GKKRK
Subcellular Location(s) nucl 9cyto_nucl 9, cyto 7, cysk 6, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR036882  Alba-like_dom_sf  
Gene Ontology GO:0003676  F:nucleic acid binding  
KEGG mpr:MPER_08144  -  
Amino Acid Sequences MGAAIPLLMHLTCALPPILPYAPKDISTEILTGTTEVMDEITPEDEDEEISYQTRAKSTLRVTMKIYGGNQVATDARGELKQGKKRKRQTSAEGDEIVVLQEPEQVEMEML
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.08
3 0.08
4 0.12
5 0.14
6 0.15
7 0.16
8 0.21
9 0.23
10 0.24
11 0.25
12 0.22
13 0.23
14 0.22
15 0.21
16 0.15
17 0.14
18 0.13
19 0.11
20 0.1
21 0.07
22 0.05
23 0.05
24 0.05
25 0.04
26 0.04
27 0.05
28 0.05
29 0.05
30 0.05
31 0.06
32 0.05
33 0.06
34 0.06
35 0.06
36 0.06
37 0.06
38 0.06
39 0.07
40 0.08
41 0.08
42 0.09
43 0.09
44 0.13
45 0.15
46 0.23
47 0.24
48 0.26
49 0.28
50 0.31
51 0.31
52 0.28
53 0.27
54 0.23
55 0.21
56 0.19
57 0.17
58 0.13
59 0.13
60 0.11
61 0.11
62 0.07
63 0.07
64 0.07
65 0.09
66 0.15
67 0.23
68 0.3
69 0.4
70 0.49
71 0.59
72 0.69
73 0.78
74 0.81
75 0.82
76 0.83
77 0.85
78 0.82
79 0.77
80 0.68
81 0.58
82 0.48
83 0.4
84 0.3
85 0.2
86 0.13
87 0.07
88 0.09
89 0.09
90 0.1
91 0.11