Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A401H642

Protein Details
Accession A0A401H642    Localization Confidence High Confidence Score 18.2
NoLS Segment(s)
PositionSequenceProtein Nature
53-77AVKDLKKLPDPKRKRQPARPEPDGEBasic
NLS Segment(s)
PositionSequence
57-72LKKLPDPKRKRQPARP
86-95PPRKRGRGTR
104-105RK
119-124PPAKRR
Subcellular Location(s) nucl 24, cyto_nucl 14.5
Family & Domain DBs
Amino Acid Sequences MEDRPSGQAKALQGRSITDALQSNIPGRITRSQRQAMDESPAKNTRSQHPLGAVKDLKKLPDPKRKRQPARPEPDGEDSSGEDNPPPRKRGRGTRDELVVASPRKKNVRAEDSDDGDKPPAKRR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.34
3 0.32
4 0.27
5 0.21
6 0.21
7 0.2
8 0.21
9 0.2
10 0.18
11 0.19
12 0.19
13 0.17
14 0.18
15 0.24
16 0.29
17 0.34
18 0.41
19 0.44
20 0.46
21 0.49
22 0.49
23 0.42
24 0.43
25 0.41
26 0.34
27 0.34
28 0.35
29 0.32
30 0.32
31 0.34
32 0.33
33 0.35
34 0.35
35 0.31
36 0.33
37 0.37
38 0.34
39 0.38
40 0.35
41 0.3
42 0.34
43 0.32
44 0.28
45 0.28
46 0.36
47 0.39
48 0.47
49 0.53
50 0.59
51 0.69
52 0.78
53 0.82
54 0.82
55 0.84
56 0.84
57 0.85
58 0.81
59 0.74
60 0.67
61 0.65
62 0.56
63 0.45
64 0.35
65 0.27
66 0.23
67 0.2
68 0.15
69 0.11
70 0.14
71 0.22
72 0.25
73 0.27
74 0.29
75 0.35
76 0.42
77 0.51
78 0.56
79 0.59
80 0.61
81 0.64
82 0.64
83 0.59
84 0.53
85 0.44
86 0.42
87 0.36
88 0.35
89 0.32
90 0.35
91 0.4
92 0.44
93 0.5
94 0.54
95 0.59
96 0.59
97 0.64
98 0.65
99 0.64
100 0.64
101 0.56
102 0.48
103 0.43
104 0.41