Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A401GNI6

Protein Details
Accession A0A401GNI6    Localization Confidence Low Confidence Score 9.2
NoLS Segment(s)
PositionSequenceProtein Nature
10-36YSSRSCFRYHPYPRARRRYDRLERVVGHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 13.5, cyto_nucl 8.5, mito 8, cyto 2.5
Family & Domain DBs
Amino Acid Sequences MDHYPRLPPYSSRSCFRYHPYPRARRRYDRLERVVGAEYGDDTEDTILDSPPPISLLPSNVFGATSNDDVSTLELDDRVYQHDESDAGRKQETLQVVKQWLAKVLVVWRKCQRLRAVQAWLPAKTQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.47
2 0.5
3 0.54
4 0.56
5 0.54
6 0.6
7 0.66
8 0.73
9 0.79
10 0.85
11 0.86
12 0.85
13 0.85
14 0.85
15 0.85
16 0.85
17 0.81
18 0.76
19 0.68
20 0.61
21 0.55
22 0.44
23 0.33
24 0.23
25 0.16
26 0.11
27 0.1
28 0.07
29 0.05
30 0.05
31 0.05
32 0.05
33 0.05
34 0.05
35 0.05
36 0.05
37 0.05
38 0.05
39 0.06
40 0.06
41 0.06
42 0.06
43 0.09
44 0.1
45 0.11
46 0.12
47 0.11
48 0.11
49 0.1
50 0.11
51 0.11
52 0.1
53 0.08
54 0.08
55 0.08
56 0.08
57 0.08
58 0.07
59 0.06
60 0.05
61 0.05
62 0.05
63 0.06
64 0.06
65 0.08
66 0.1
67 0.1
68 0.1
69 0.11
70 0.11
71 0.12
72 0.17
73 0.18
74 0.17
75 0.17
76 0.18
77 0.18
78 0.22
79 0.25
80 0.24
81 0.24
82 0.27
83 0.29
84 0.31
85 0.33
86 0.29
87 0.27
88 0.24
89 0.22
90 0.19
91 0.25
92 0.3
93 0.29
94 0.35
95 0.39
96 0.47
97 0.5
98 0.55
99 0.55
100 0.58
101 0.65
102 0.65
103 0.67
104 0.61
105 0.66
106 0.64