Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G7X551

Protein Details
Accession G7X551   
Localization Confidence Medium
Confidence Score 13.4
NoLS Segment(s)
PositionSequenceProtein Nature
33-59SNRKIPWRLSQPQKARQRKRLRGVDRVHydrophilic
94-125DKYTLFDKKEKKYRKGIHKLPKWTRVSQRVNPHydrophilic
NLS Segment(s)
PositionSequence
46-52KARQRKR
101-115KKEKKYRKGIHKLPK
Subcellular Location(s) mito 20.5, cyto_mito 11, nucl 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR016340  Ribosomal_L31_mit  
Gene Ontology GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF09784  L31  
Amino Acid Sequences MMFKPSSPLFSGLLCHSPVVIIMRSEANITRQSNRKIPWRLSQPQKARQRKRLRGVDRVVDTVSAALERNGYTTKAVERWYREMPREEEMLPKDKYTLFDKKEKKYRKGIHKLPKWTRVSQRVNPPGF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.19
3 0.16
4 0.14
5 0.15
6 0.15
7 0.14
8 0.11
9 0.12
10 0.13
11 0.13
12 0.14
13 0.14
14 0.14
15 0.19
16 0.21
17 0.26
18 0.33
19 0.37
20 0.42
21 0.45
22 0.52
23 0.53
24 0.55
25 0.57
26 0.59
27 0.63
28 0.66
29 0.72
30 0.71
31 0.73
32 0.79
33 0.81
34 0.81
35 0.82
36 0.84
37 0.84
38 0.85
39 0.86
40 0.81
41 0.8
42 0.75
43 0.71
44 0.62
45 0.54
46 0.44
47 0.34
48 0.27
49 0.18
50 0.14
51 0.08
52 0.06
53 0.04
54 0.05
55 0.05
56 0.06
57 0.07
58 0.07
59 0.07
60 0.08
61 0.1
62 0.12
63 0.15
64 0.18
65 0.21
66 0.25
67 0.32
68 0.35
69 0.38
70 0.4
71 0.4
72 0.39
73 0.38
74 0.33
75 0.32
76 0.31
77 0.33
78 0.29
79 0.27
80 0.25
81 0.24
82 0.27
83 0.27
84 0.33
85 0.32
86 0.41
87 0.48
88 0.56
89 0.65
90 0.72
91 0.73
92 0.75
93 0.8
94 0.82
95 0.85
96 0.85
97 0.86
98 0.86
99 0.89
100 0.88
101 0.88
102 0.83
103 0.81
104 0.81
105 0.8
106 0.8
107 0.78
108 0.79