Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A401GVU5

Protein Details
Accession A0A401GVU5    Localization Confidence Low Confidence Score 7.6
NoLS Segment(s)
PositionSequenceProtein Nature
83-106GSTTKLPSRRRCKHYTTLSKPGTCHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 12, cyto_nucl 10.333, mito_nucl 9.833, cyto 7.5, mito 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036812  NADP_OxRdtase_dom_sf  
Amino Acid Sequences MTKLFMPMTPGKWGTNIFSSEQSADEIGLVNQHGLSRKHIFDVVKASLERLWLDYIDLRQCWHCVSLSANGTSLPNIGIQAIGSTTKLPSRRRCKHYTTLSKPGTCATSA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.28
3 0.28
4 0.24
5 0.24
6 0.25
7 0.23
8 0.22
9 0.2
10 0.16
11 0.13
12 0.11
13 0.09
14 0.07
15 0.08
16 0.07
17 0.06
18 0.06
19 0.07
20 0.11
21 0.12
22 0.17
23 0.2
24 0.21
25 0.22
26 0.25
27 0.24
28 0.22
29 0.27
30 0.23
31 0.22
32 0.21
33 0.2
34 0.17
35 0.17
36 0.15
37 0.11
38 0.1
39 0.08
40 0.08
41 0.09
42 0.1
43 0.11
44 0.1
45 0.1
46 0.1
47 0.11
48 0.11
49 0.11
50 0.09
51 0.08
52 0.11
53 0.15
54 0.17
55 0.16
56 0.16
57 0.16
58 0.16
59 0.15
60 0.13
61 0.08
62 0.06
63 0.06
64 0.06
65 0.05
66 0.05
67 0.05
68 0.05
69 0.06
70 0.06
71 0.06
72 0.07
73 0.12
74 0.19
75 0.26
76 0.36
77 0.47
78 0.56
79 0.64
80 0.71
81 0.75
82 0.78
83 0.82
84 0.83
85 0.81
86 0.81
87 0.81
88 0.75
89 0.68
90 0.61