Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A401GHF3

Protein Details
Accession A0A401GHF3    Localization Confidence Low Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
1-20MGRSAKVHKRTKKTVSSTSAHydrophilic
NLS Segment(s)
PositionSequence
43-61QKKRAGLKAKAKGASKRRG
Subcellular Location(s) mito 21, nucl 5
Family & Domain DBs
Amino Acid Sequences MGRSAKVHKRTKKTVSSTSAAASAPIPPHKVKQTALGAAPQEQKKRAGLKAKAKGASKRRGDEGPILGGADYVELMLGGRRRAMDEAGKLSGKE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.81
2 0.77
3 0.71
4 0.63
5 0.54
6 0.47
7 0.37
8 0.29
9 0.2
10 0.17
11 0.16
12 0.17
13 0.19
14 0.18
15 0.22
16 0.26
17 0.29
18 0.27
19 0.32
20 0.33
21 0.33
22 0.32
23 0.31
24 0.27
25 0.27
26 0.32
27 0.28
28 0.27
29 0.25
30 0.26
31 0.27
32 0.3
33 0.31
34 0.34
35 0.38
36 0.45
37 0.51
38 0.55
39 0.56
40 0.56
41 0.59
42 0.59
43 0.61
44 0.57
45 0.53
46 0.51
47 0.48
48 0.47
49 0.44
50 0.38
51 0.31
52 0.25
53 0.22
54 0.18
55 0.16
56 0.13
57 0.08
58 0.06
59 0.03
60 0.03
61 0.03
62 0.03
63 0.06
64 0.08
65 0.08
66 0.1
67 0.11
68 0.13
69 0.15
70 0.19
71 0.22
72 0.25
73 0.29
74 0.32