Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A401H1H0

Protein Details
Accession A0A401H1H0    Localization Confidence Medium Confidence Score 11.1
NoLS Segment(s)
PositionSequenceProtein Nature
73-94VSDKRQWDGKKKPKKSSMNVRTHydrophilic
NLS Segment(s)
PositionSequence
62-87GRSAKGRARRTVSDKRQWDGKKKPKK
Subcellular Location(s) mito 14, nucl 8, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR039723  Vps71/ZNHIT1  
IPR007529  Znf_HIT  
Gene Ontology GO:0005634  C:nucleus  
GO:0006338  P:chromatin remodeling  
Pfam View protein in Pfam  
PF04438  zf-HIT  
PROSITE View protein in PROSITE  
PS51083  ZF_HIT  
Amino Acid Sequences MAPRRQPTRQTQAASSSAQLDPELVAKRTKRHLDELERSNYTEPSDALFHGLGEDEDGGAGGRSAKGRARRTVSDKRQWDGKKKPKKSSMNVRTAVLYKKNLAVLLDESGIANYPPGVPTYLTAVAPPPLQPPQLFCSVCGFWGKYKCKKCAMPYCDLNCQGIHDETRCERRVV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.52
2 0.44
3 0.38
4 0.3
5 0.26
6 0.22
7 0.17
8 0.13
9 0.16
10 0.18
11 0.16
12 0.21
13 0.23
14 0.29
15 0.37
16 0.44
17 0.44
18 0.49
19 0.57
20 0.61
21 0.67
22 0.69
23 0.67
24 0.61
25 0.58
26 0.51
27 0.43
28 0.34
29 0.27
30 0.2
31 0.15
32 0.15
33 0.13
34 0.14
35 0.13
36 0.11
37 0.1
38 0.1
39 0.07
40 0.06
41 0.06
42 0.04
43 0.04
44 0.04
45 0.04
46 0.03
47 0.04
48 0.03
49 0.05
50 0.05
51 0.07
52 0.11
53 0.19
54 0.23
55 0.3
56 0.34
57 0.39
58 0.47
59 0.56
60 0.61
61 0.62
62 0.61
63 0.57
64 0.6
65 0.6
66 0.61
67 0.61
68 0.63
69 0.64
70 0.68
71 0.75
72 0.77
73 0.81
74 0.8
75 0.81
76 0.8
77 0.78
78 0.72
79 0.64
80 0.55
81 0.49
82 0.44
83 0.36
84 0.28
85 0.2
86 0.2
87 0.2
88 0.18
89 0.16
90 0.14
91 0.12
92 0.12
93 0.11
94 0.09
95 0.08
96 0.08
97 0.08
98 0.06
99 0.05
100 0.04
101 0.04
102 0.04
103 0.05
104 0.06
105 0.06
106 0.07
107 0.11
108 0.13
109 0.12
110 0.12
111 0.13
112 0.13
113 0.14
114 0.14
115 0.13
116 0.13
117 0.15
118 0.16
119 0.18
120 0.2
121 0.28
122 0.27
123 0.25
124 0.28
125 0.27
126 0.28
127 0.28
128 0.25
129 0.23
130 0.32
131 0.39
132 0.43
133 0.51
134 0.56
135 0.61
136 0.67
137 0.71
138 0.73
139 0.71
140 0.71
141 0.72
142 0.72
143 0.72
144 0.67
145 0.59
146 0.48
147 0.44
148 0.39
149 0.33
150 0.31
151 0.24
152 0.28
153 0.33
154 0.41