Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A401GFL6

Protein Details
Accession A0A401GFL6    Localization Confidence Medium Confidence Score 10.5
NoLS Segment(s)
PositionSequenceProtein Nature
70-114SRGTEYQPSQRKRKRKHGFLARKRSVNGQKILQRRRVKGRRFLTHHydrophilic
NLS Segment(s)
PositionSequence
79-110QRKRKRKHGFLARKRSVNGQKILQRRRVKGRR
Subcellular Location(s) mito 18, nucl 7.5, cyto_nucl 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000271  Ribosomal_L34  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00468  Ribosomal_L34  
Amino Acid Sequences MPRIPLQLFRVLARPPTLHPVPRVASLISILSSRPLLPQPTPSVLLACAFRNPVSLSLPSAIIQQARHKSRGTEYQPSQRKRKRKHGFLARKRSVNGQKILQRRRVKGRRFLTH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.26
3 0.32
4 0.35
5 0.35
6 0.35
7 0.38
8 0.36
9 0.37
10 0.36
11 0.28
12 0.24
13 0.21
14 0.2
15 0.14
16 0.12
17 0.09
18 0.09
19 0.09
20 0.09
21 0.1
22 0.12
23 0.14
24 0.14
25 0.19
26 0.21
27 0.23
28 0.24
29 0.23
30 0.21
31 0.18
32 0.18
33 0.16
34 0.13
35 0.11
36 0.1
37 0.1
38 0.1
39 0.11
40 0.11
41 0.11
42 0.11
43 0.11
44 0.11
45 0.11
46 0.1
47 0.1
48 0.1
49 0.09
50 0.1
51 0.15
52 0.22
53 0.24
54 0.27
55 0.27
56 0.28
57 0.31
58 0.39
59 0.39
60 0.41
61 0.43
62 0.5
63 0.59
64 0.63
65 0.7
66 0.68
67 0.73
68 0.73
69 0.8
70 0.8
71 0.82
72 0.86
73 0.87
74 0.91
75 0.91
76 0.93
77 0.89
78 0.84
79 0.75
80 0.74
81 0.72
82 0.69
83 0.63
84 0.6
85 0.6
86 0.65
87 0.72
88 0.72
89 0.71
90 0.71
91 0.77
92 0.79
93 0.8
94 0.8