Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A401GHR7

Protein Details
Accession A0A401GHR7    Localization Confidence Medium Confidence Score 13.4
NoLS Segment(s)
PositionSequenceProtein Nature
45-72VDTSKKVPAERKNKKDRNNVKKTDKLKQHydrophilic
NLS Segment(s)
PositionSequence
49-80KKVPAERKNKKDRNNVKKTDKLKQSHAKKAKA
Subcellular Location(s) nucl 20.5, cyto_nucl 13, cyto 4.5
Family & Domain DBs
Amino Acid Sequences MKVSYSEPSEIKGWSDLKEAKQEKVHCAWKEDTISDENESIKEAVDTSKKVPAERKNKKDRNNVKKTDKLKQSHAKKAKADKEDEEEAKEEKDE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.26
3 0.28
4 0.29
5 0.38
6 0.39
7 0.39
8 0.44
9 0.45
10 0.44
11 0.47
12 0.52
13 0.44
14 0.46
15 0.44
16 0.41
17 0.41
18 0.36
19 0.31
20 0.25
21 0.25
22 0.21
23 0.2
24 0.16
25 0.14
26 0.14
27 0.11
28 0.09
29 0.08
30 0.07
31 0.08
32 0.1
33 0.11
34 0.11
35 0.15
36 0.16
37 0.17
38 0.24
39 0.31
40 0.4
41 0.5
42 0.58
43 0.66
44 0.73
45 0.81
46 0.85
47 0.86
48 0.86
49 0.87
50 0.86
51 0.83
52 0.84
53 0.81
54 0.79
55 0.78
56 0.71
57 0.71
58 0.72
59 0.72
60 0.74
61 0.77
62 0.75
63 0.74
64 0.79
65 0.78
66 0.75
67 0.72
68 0.66
69 0.64
70 0.65
71 0.59
72 0.52
73 0.46
74 0.4