Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A401GGH1

Protein Details
Accession A0A401GGH1    Localization Confidence Medium Confidence Score 10.7
NoLS Segment(s)
PositionSequenceProtein Nature
4-23NESTQPPRPQRKPSIDPQTAHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 22.5, cyto_nucl 13.5, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR043451  Myocardin-like  
IPR004018  RPEL_repeat  
Pfam View protein in Pfam  
PF02755  RPEL  
PROSITE View protein in PROSITE  
PS51073  RPEL  
Amino Acid Sequences MSTNESTQPPRPQRKPSIDPQTADRLERYLNQRPDKHDLIDRNILKEDNVAPSLQAAKEKLQRSQLEDKLEHALQQRPKPEELVKGGILLDNEAPPS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.8
2 0.8
3 0.8
4 0.8
5 0.75
6 0.7
7 0.65
8 0.64
9 0.56
10 0.51
11 0.41
12 0.31
13 0.27
14 0.31
15 0.33
16 0.33
17 0.39
18 0.45
19 0.48
20 0.52
21 0.58
22 0.54
23 0.5
24 0.47
25 0.42
26 0.4
27 0.45
28 0.4
29 0.35
30 0.34
31 0.31
32 0.25
33 0.23
34 0.19
35 0.12
36 0.12
37 0.1
38 0.09
39 0.09
40 0.11
41 0.1
42 0.1
43 0.09
44 0.13
45 0.2
46 0.22
47 0.24
48 0.3
49 0.32
50 0.37
51 0.45
52 0.45
53 0.44
54 0.43
55 0.42
56 0.39
57 0.38
58 0.34
59 0.29
60 0.31
61 0.32
62 0.37
63 0.41
64 0.4
65 0.41
66 0.43
67 0.43
68 0.43
69 0.42
70 0.42
71 0.35
72 0.32
73 0.31
74 0.28
75 0.25
76 0.2
77 0.16