Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A401GLB3

Protein Details
Accession A0A401GLB3    Localization Confidence Medium Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
572-592SHELHRQQRQQHDRLRQAQREHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 25, cyto_nucl 14.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036236  Znf_C2H2_sf  
IPR013087  Znf_C2H2_type  
Pfam View protein in Pfam  
PF00096  zf-C2H2  
PROSITE View protein in PROSITE  
PS50157  ZINC_FINGER_C2H2_2  
Amino Acid Sequences MDNSKSPQNSPPDDDDVRPDMAAAVAQPAVPPPPPASPPAASTAAPAGVGVNKRYRAAPAKTFQCRGYGECRMVFSRSEHLARHIRKHTGERPFTCHCSKQFSRLDNLRQHAQTVHADKQDQNERMMHELTSLHASMTAANKGAPARGKRAQLPAPDPALTDAADHVSVKQEEPSHVLPPVHQRPGTSTGYEGGYHTGSTIPFVIPASPFLPPPHPRSHPPLLPQQRQPPSHTSTPASPFGSPPTPLSTSVSPTSQSGFAPDLATALRHTPPDPSRHSLPSSPHPSLAPSLSRHPPSPPRHLTSSSSSNPSLTPMYYPYLPHPNMASMLDGHPQPLAPEPLPLHTTTPLFTLQELEQYRQWLRYDQNYHFHNHPMPMDVPASHYADSELAAAQQQQQQQMQEDMNASRRLPGEHTTTPHFPSTLPPLQQPRTHPQLRTRASQPILASDLIRDQTMMARVSEEMLAAQLAAAGASGSSTAGTTTTTTTTGPILGPSLGASPSWSSAMTPMQMEPPFDHFFPYPQQQQQAGPTRGPPPHPDSALAPRSSHSSIGHPLPLPTLQGPIAAQAHRYSHELHRQQRQQHDRLRQAQREGRRSEQAYLHPQQYVDYQHPCAGTQHGRPSPSPSISPHGQQGPADAHPYFQGPAQGYPDGSGTTLGRDSEEAYRHHAAMMDGAYHMMDAGDPLDLVGVPGVQGSSPAGMIKYESPLPLE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.52
2 0.51
3 0.46
4 0.41
5 0.35
6 0.29
7 0.21
8 0.18
9 0.17
10 0.11
11 0.1
12 0.09
13 0.09
14 0.09
15 0.1
16 0.12
17 0.13
18 0.15
19 0.15
20 0.2
21 0.22
22 0.25
23 0.3
24 0.29
25 0.3
26 0.34
27 0.34
28 0.29
29 0.28
30 0.27
31 0.22
32 0.19
33 0.17
34 0.13
35 0.14
36 0.17
37 0.2
38 0.24
39 0.26
40 0.28
41 0.29
42 0.35
43 0.39
44 0.43
45 0.48
46 0.51
47 0.58
48 0.64
49 0.67
50 0.61
51 0.58
52 0.54
53 0.49
54 0.48
55 0.46
56 0.43
57 0.41
58 0.44
59 0.4
60 0.39
61 0.37
62 0.32
63 0.31
64 0.32
65 0.33
66 0.31
67 0.36
68 0.44
69 0.48
70 0.54
71 0.54
72 0.55
73 0.57
74 0.65
75 0.66
76 0.67
77 0.71
78 0.66
79 0.67
80 0.66
81 0.67
82 0.64
83 0.62
84 0.54
85 0.54
86 0.53
87 0.56
88 0.57
89 0.55
90 0.58
91 0.6
92 0.66
93 0.64
94 0.67
95 0.64
96 0.57
97 0.54
98 0.46
99 0.42
100 0.41
101 0.38
102 0.39
103 0.35
104 0.37
105 0.37
106 0.44
107 0.49
108 0.44
109 0.41
110 0.38
111 0.37
112 0.38
113 0.37
114 0.28
115 0.21
116 0.19
117 0.18
118 0.18
119 0.16
120 0.13
121 0.12
122 0.12
123 0.14
124 0.16
125 0.16
126 0.13
127 0.13
128 0.15
129 0.14
130 0.18
131 0.21
132 0.22
133 0.28
134 0.33
135 0.38
136 0.41
137 0.48
138 0.5
139 0.5
140 0.51
141 0.49
142 0.46
143 0.42
144 0.38
145 0.32
146 0.27
147 0.21
148 0.17
149 0.12
150 0.11
151 0.11
152 0.1
153 0.09
154 0.13
155 0.13
156 0.13
157 0.16
158 0.17
159 0.17
160 0.22
161 0.24
162 0.21
163 0.24
164 0.23
165 0.23
166 0.31
167 0.36
168 0.37
169 0.36
170 0.34
171 0.36
172 0.43
173 0.42
174 0.33
175 0.27
176 0.23
177 0.24
178 0.24
179 0.19
180 0.15
181 0.13
182 0.12
183 0.11
184 0.11
185 0.09
186 0.1
187 0.1
188 0.08
189 0.08
190 0.09
191 0.1
192 0.08
193 0.11
194 0.11
195 0.11
196 0.12
197 0.13
198 0.2
199 0.23
200 0.29
201 0.34
202 0.37
203 0.4
204 0.47
205 0.53
206 0.5
207 0.5
208 0.55
209 0.57
210 0.6
211 0.62
212 0.64
213 0.64
214 0.62
215 0.62
216 0.58
217 0.54
218 0.52
219 0.49
220 0.42
221 0.39
222 0.41
223 0.41
224 0.36
225 0.31
226 0.27
227 0.28
228 0.27
229 0.23
230 0.2
231 0.21
232 0.21
233 0.21
234 0.24
235 0.21
236 0.22
237 0.23
238 0.22
239 0.18
240 0.17
241 0.18
242 0.16
243 0.14
244 0.13
245 0.12
246 0.12
247 0.12
248 0.11
249 0.1
250 0.09
251 0.09
252 0.08
253 0.09
254 0.1
255 0.1
256 0.11
257 0.16
258 0.2
259 0.25
260 0.3
261 0.33
262 0.35
263 0.38
264 0.4
265 0.38
266 0.39
267 0.41
268 0.43
269 0.39
270 0.37
271 0.33
272 0.32
273 0.3
274 0.28
275 0.22
276 0.17
277 0.21
278 0.25
279 0.27
280 0.26
281 0.3
282 0.37
283 0.4
284 0.47
285 0.48
286 0.47
287 0.49
288 0.51
289 0.5
290 0.46
291 0.47
292 0.4
293 0.38
294 0.34
295 0.3
296 0.27
297 0.26
298 0.21
299 0.14
300 0.13
301 0.11
302 0.13
303 0.13
304 0.14
305 0.15
306 0.22
307 0.22
308 0.22
309 0.2
310 0.19
311 0.19
312 0.19
313 0.16
314 0.09
315 0.1
316 0.11
317 0.1
318 0.1
319 0.09
320 0.08
321 0.08
322 0.09
323 0.1
324 0.08
325 0.11
326 0.11
327 0.12
328 0.14
329 0.14
330 0.13
331 0.13
332 0.13
333 0.11
334 0.12
335 0.11
336 0.1
337 0.1
338 0.11
339 0.09
340 0.15
341 0.16
342 0.16
343 0.16
344 0.18
345 0.19
346 0.19
347 0.19
348 0.17
349 0.18
350 0.24
351 0.29
352 0.3
353 0.36
354 0.35
355 0.38
356 0.36
357 0.36
358 0.3
359 0.26
360 0.23
361 0.19
362 0.17
363 0.16
364 0.15
365 0.13
366 0.14
367 0.14
368 0.15
369 0.13
370 0.12
371 0.11
372 0.11
373 0.11
374 0.09
375 0.07
376 0.05
377 0.05
378 0.06
379 0.08
380 0.11
381 0.12
382 0.14
383 0.16
384 0.16
385 0.17
386 0.19
387 0.17
388 0.15
389 0.14
390 0.14
391 0.16
392 0.17
393 0.16
394 0.16
395 0.17
396 0.17
397 0.17
398 0.19
399 0.22
400 0.23
401 0.26
402 0.27
403 0.29
404 0.3
405 0.28
406 0.25
407 0.19
408 0.19
409 0.25
410 0.25
411 0.24
412 0.26
413 0.32
414 0.35
415 0.39
416 0.41
417 0.39
418 0.43
419 0.46
420 0.45
421 0.47
422 0.54
423 0.54
424 0.54
425 0.5
426 0.49
427 0.46
428 0.46
429 0.38
430 0.3
431 0.29
432 0.24
433 0.21
434 0.14
435 0.15
436 0.13
437 0.12
438 0.1
439 0.08
440 0.1
441 0.12
442 0.13
443 0.1
444 0.11
445 0.11
446 0.12
447 0.11
448 0.09
449 0.06
450 0.06
451 0.05
452 0.04
453 0.04
454 0.03
455 0.03
456 0.03
457 0.03
458 0.02
459 0.02
460 0.02
461 0.03
462 0.02
463 0.03
464 0.03
465 0.03
466 0.03
467 0.04
468 0.05
469 0.06
470 0.07
471 0.08
472 0.09
473 0.09
474 0.1
475 0.1
476 0.09
477 0.08
478 0.08
479 0.08
480 0.07
481 0.07
482 0.08
483 0.07
484 0.07
485 0.07
486 0.07
487 0.08
488 0.09
489 0.08
490 0.08
491 0.09
492 0.11
493 0.11
494 0.11
495 0.11
496 0.16
497 0.17
498 0.18
499 0.17
500 0.21
501 0.23
502 0.22
503 0.24
504 0.19
505 0.21
506 0.24
507 0.29
508 0.29
509 0.3
510 0.34
511 0.33
512 0.35
513 0.41
514 0.46
515 0.42
516 0.38
517 0.38
518 0.4
519 0.41
520 0.42
521 0.39
522 0.36
523 0.38
524 0.38
525 0.37
526 0.35
527 0.4
528 0.43
529 0.39
530 0.33
531 0.29
532 0.32
533 0.32
534 0.3
535 0.23
536 0.21
537 0.24
538 0.27
539 0.29
540 0.25
541 0.24
542 0.24
543 0.23
544 0.21
545 0.17
546 0.17
547 0.13
548 0.14
549 0.13
550 0.15
551 0.17
552 0.15
553 0.16
554 0.16
555 0.18
556 0.19
557 0.21
558 0.21
559 0.25
560 0.35
561 0.42
562 0.47
563 0.56
564 0.61
565 0.67
566 0.74
567 0.76
568 0.75
569 0.76
570 0.78
571 0.78
572 0.8
573 0.83
574 0.78
575 0.77
576 0.76
577 0.76
578 0.75
579 0.72
580 0.67
581 0.65
582 0.62
583 0.58
584 0.57
585 0.54
586 0.54
587 0.53
588 0.5
589 0.43
590 0.4
591 0.36
592 0.34
593 0.32
594 0.29
595 0.28
596 0.28
597 0.3
598 0.3
599 0.3
600 0.28
601 0.3
602 0.3
603 0.32
604 0.39
605 0.4
606 0.43
607 0.43
608 0.49
609 0.49
610 0.47
611 0.44
612 0.38
613 0.41
614 0.41
615 0.43
616 0.42
617 0.39
618 0.38
619 0.35
620 0.34
621 0.31
622 0.3
623 0.31
624 0.24
625 0.21
626 0.2
627 0.21
628 0.18
629 0.15
630 0.19
631 0.17
632 0.2
633 0.23
634 0.24
635 0.22
636 0.22
637 0.22
638 0.18
639 0.16
640 0.15
641 0.12
642 0.13
643 0.14
644 0.14
645 0.14
646 0.14
647 0.16
648 0.2
649 0.24
650 0.23
651 0.28
652 0.31
653 0.3
654 0.3
655 0.29
656 0.24
657 0.23
658 0.22
659 0.17
660 0.14
661 0.14
662 0.13
663 0.1
664 0.1
665 0.06
666 0.05
667 0.05
668 0.05
669 0.05
670 0.05
671 0.05
672 0.05
673 0.05
674 0.06
675 0.05
676 0.05
677 0.05
678 0.05
679 0.06
680 0.05
681 0.06
682 0.07
683 0.07
684 0.08
685 0.09
686 0.09
687 0.09
688 0.12
689 0.13
690 0.16
691 0.18