Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A401G5V0

Protein Details
Accession A0A401G5V0    Localization Confidence High Confidence Score 16.1
NoLS Segment(s)
PositionSequenceProtein Nature
9-29TAKKNTTTRKRKASGGRKKLTHydrophilic
NLS Segment(s)
PositionSequence
17-27RKRKASGGRKK
Subcellular Location(s) nucl 21, mito 3, cyto 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR036910  HMG_box_dom_sf  
IPR006780  YABBY  
Gene Ontology GO:0005634  C:nucleus  
Pfam View protein in Pfam  
PF04690  YABBY  
Amino Acid Sequences MVVPASTETAKKNTTTRKRKASGGRKKLTDFNKFMQTEVARLKEQDPDMPHRDRFKLVIENWNKQKEKDK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.47
2 0.56
3 0.62
4 0.68
5 0.7
6 0.76
7 0.8
8 0.8
9 0.8
10 0.8
11 0.78
12 0.72
13 0.71
14 0.7
15 0.67
16 0.64
17 0.56
18 0.49
19 0.51
20 0.47
21 0.44
22 0.41
23 0.34
24 0.29
25 0.28
26 0.27
27 0.19
28 0.19
29 0.2
30 0.21
31 0.21
32 0.22
33 0.23
34 0.27
35 0.33
36 0.36
37 0.39
38 0.4
39 0.41
40 0.39
41 0.37
42 0.36
43 0.38
44 0.37
45 0.43
46 0.45
47 0.52
48 0.59
49 0.66
50 0.63