Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A401G8J3

Protein Details
Accession A0A401G8J3    Localization Confidence High Confidence Score 15.4
NoLS Segment(s)
PositionSequenceProtein Nature
105-127ADAPAKPKRKSPKMKANKSNDASHydrophilic
NLS Segment(s)
PositionSequence
109-120AKPKRKSPKMKA
179-182KRKA
Subcellular Location(s) nucl 20.5, cyto_nucl 13, cyto 4.5
Family & Domain DBs
Amino Acid Sequences MLDSRLPEHQPHASSSESANVDVSGDDPTQLRPDSTVPSTSVVALHTTHVDAQSIPLVVPFDPLADEFDPPTPYSLPTQSKTTSASGTAGTGVAPADSDLRATAADAPAKPKRKSPKMKANKSNDASNLFAIDWLPTNQGKSRDEFSAAWAAVDAETRKKYEVLSATKKTAAKMEEAAKRKASRATKATNKSNANIAGASQAT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.28
3 0.3
4 0.25
5 0.23
6 0.21
7 0.18
8 0.17
9 0.15
10 0.15
11 0.1
12 0.09
13 0.1
14 0.1
15 0.11
16 0.14
17 0.15
18 0.15
19 0.14
20 0.16
21 0.2
22 0.22
23 0.22
24 0.2
25 0.22
26 0.22
27 0.21
28 0.19
29 0.15
30 0.14
31 0.12
32 0.12
33 0.1
34 0.11
35 0.11
36 0.11
37 0.11
38 0.09
39 0.1
40 0.1
41 0.1
42 0.09
43 0.08
44 0.09
45 0.08
46 0.09
47 0.08
48 0.07
49 0.07
50 0.07
51 0.1
52 0.1
53 0.1
54 0.1
55 0.12
56 0.13
57 0.13
58 0.14
59 0.11
60 0.12
61 0.14
62 0.19
63 0.21
64 0.22
65 0.26
66 0.25
67 0.26
68 0.27
69 0.27
70 0.21
71 0.18
72 0.16
73 0.13
74 0.12
75 0.11
76 0.08
77 0.07
78 0.06
79 0.05
80 0.04
81 0.04
82 0.04
83 0.04
84 0.04
85 0.04
86 0.04
87 0.04
88 0.04
89 0.05
90 0.06
91 0.06
92 0.08
93 0.08
94 0.13
95 0.19
96 0.26
97 0.26
98 0.32
99 0.4
100 0.49
101 0.59
102 0.64
103 0.7
104 0.74
105 0.84
106 0.88
107 0.87
108 0.86
109 0.78
110 0.73
111 0.64
112 0.56
113 0.47
114 0.38
115 0.3
116 0.2
117 0.17
118 0.13
119 0.1
120 0.08
121 0.08
122 0.1
123 0.1
124 0.12
125 0.15
126 0.2
127 0.21
128 0.22
129 0.25
130 0.24
131 0.27
132 0.25
133 0.25
134 0.26
135 0.24
136 0.21
137 0.18
138 0.17
139 0.13
140 0.15
141 0.14
142 0.13
143 0.15
144 0.16
145 0.17
146 0.18
147 0.18
148 0.22
149 0.29
150 0.33
151 0.4
152 0.43
153 0.45
154 0.5
155 0.51
156 0.45
157 0.43
158 0.35
159 0.29
160 0.31
161 0.36
162 0.39
163 0.43
164 0.46
165 0.47
166 0.48
167 0.48
168 0.51
169 0.5
170 0.5
171 0.53
172 0.59
173 0.63
174 0.7
175 0.76
176 0.76
177 0.74
178 0.67
179 0.66
180 0.58
181 0.5
182 0.41
183 0.33