Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G7X6W6

Protein Details
Accession G7X6W6    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
208-227LYFWRKWKSKKAAEEERRKEBasic
NLS Segment(s)
Subcellular Location(s) extr 25
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MSSGAAAAAAGAAAATSANAAGAATTTPTETQAETTSQSTTEATPTSEATTSQETSAEPTTSVSTPSTTSTSSTSESTSSATTTSIPSTSSTSTSSTSTTEAPSTTTSATSHTTATPVVTEVVTTTPSNGSTGGVETLTITSTDTTLPTGTAGTVGNGVTATGSGSAAAASSTGGSGGGSSGLSAGGTIAVAVVVPVASVAIIILAALYFWRKWKSKKAAEEERRKEVEEYGFNPNNDPSLPPIMGGGAFEPKDDNTSSGYRGWGTTSAGRKASTNLSSSAGVGLAMSEAGSAPGYHHAATPSDGTIQYSEGQGTLGETEPIGVLGAAPAAAANSRNVDIHRGPSNASSAYSAANHSEASEESHMSATHPSGGFYDDNPYYNDMQPQYGAYGDGPYGGAPPVIRDVQARRNTRIENPAVFPRQGNAGIAQNF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.02
2 0.02
3 0.03
4 0.03
5 0.03
6 0.03
7 0.03
8 0.03
9 0.04
10 0.05
11 0.05
12 0.06
13 0.08
14 0.08
15 0.1
16 0.12
17 0.12
18 0.14
19 0.16
20 0.17
21 0.18
22 0.19
23 0.18
24 0.17
25 0.18
26 0.17
27 0.16
28 0.16
29 0.15
30 0.15
31 0.15
32 0.16
33 0.18
34 0.17
35 0.16
36 0.17
37 0.2
38 0.2
39 0.19
40 0.19
41 0.17
42 0.2
43 0.22
44 0.19
45 0.15
46 0.15
47 0.18
48 0.17
49 0.19
50 0.16
51 0.14
52 0.15
53 0.17
54 0.18
55 0.16
56 0.17
57 0.18
58 0.2
59 0.21
60 0.21
61 0.2
62 0.18
63 0.18
64 0.18
65 0.16
66 0.14
67 0.12
68 0.11
69 0.11
70 0.12
71 0.13
72 0.11
73 0.12
74 0.12
75 0.15
76 0.16
77 0.17
78 0.17
79 0.18
80 0.19
81 0.19
82 0.19
83 0.17
84 0.18
85 0.17
86 0.17
87 0.16
88 0.15
89 0.15
90 0.15
91 0.16
92 0.15
93 0.14
94 0.13
95 0.14
96 0.16
97 0.16
98 0.16
99 0.14
100 0.15
101 0.14
102 0.14
103 0.12
104 0.1
105 0.1
106 0.08
107 0.08
108 0.07
109 0.08
110 0.1
111 0.09
112 0.09
113 0.09
114 0.1
115 0.11
116 0.1
117 0.1
118 0.08
119 0.09
120 0.09
121 0.08
122 0.07
123 0.07
124 0.07
125 0.07
126 0.06
127 0.06
128 0.05
129 0.06
130 0.07
131 0.06
132 0.07
133 0.07
134 0.07
135 0.07
136 0.07
137 0.06
138 0.07
139 0.06
140 0.06
141 0.07
142 0.06
143 0.06
144 0.06
145 0.06
146 0.04
147 0.04
148 0.04
149 0.04
150 0.04
151 0.03
152 0.04
153 0.04
154 0.04
155 0.03
156 0.03
157 0.03
158 0.03
159 0.03
160 0.03
161 0.03
162 0.03
163 0.03
164 0.03
165 0.03
166 0.03
167 0.03
168 0.03
169 0.03
170 0.03
171 0.03
172 0.03
173 0.02
174 0.02
175 0.02
176 0.02
177 0.02
178 0.02
179 0.02
180 0.02
181 0.02
182 0.02
183 0.02
184 0.02
185 0.02
186 0.02
187 0.02
188 0.02
189 0.02
190 0.02
191 0.02
192 0.02
193 0.02
194 0.02
195 0.03
196 0.03
197 0.06
198 0.1
199 0.14
200 0.18
201 0.28
202 0.38
203 0.45
204 0.53
205 0.61
206 0.67
207 0.74
208 0.81
209 0.76
210 0.73
211 0.67
212 0.6
213 0.51
214 0.43
215 0.38
216 0.3
217 0.28
218 0.29
219 0.31
220 0.3
221 0.3
222 0.27
223 0.23
224 0.2
225 0.18
226 0.12
227 0.12
228 0.12
229 0.11
230 0.11
231 0.1
232 0.1
233 0.1
234 0.08
235 0.07
236 0.07
237 0.07
238 0.08
239 0.08
240 0.1
241 0.1
242 0.1
243 0.11
244 0.12
245 0.14
246 0.14
247 0.15
248 0.14
249 0.14
250 0.14
251 0.12
252 0.12
253 0.16
254 0.19
255 0.22
256 0.23
257 0.23
258 0.22
259 0.24
260 0.27
261 0.24
262 0.22
263 0.2
264 0.21
265 0.21
266 0.2
267 0.18
268 0.13
269 0.1
270 0.08
271 0.06
272 0.04
273 0.03
274 0.03
275 0.03
276 0.03
277 0.03
278 0.03
279 0.03
280 0.04
281 0.07
282 0.09
283 0.09
284 0.1
285 0.11
286 0.12
287 0.13
288 0.13
289 0.11
290 0.12
291 0.12
292 0.12
293 0.12
294 0.12
295 0.12
296 0.11
297 0.1
298 0.08
299 0.08
300 0.07
301 0.07
302 0.07
303 0.07
304 0.06
305 0.06
306 0.06
307 0.06
308 0.06
309 0.06
310 0.04
311 0.04
312 0.03
313 0.04
314 0.03
315 0.03
316 0.03
317 0.03
318 0.04
319 0.05
320 0.06
321 0.08
322 0.09
323 0.1
324 0.11
325 0.17
326 0.18
327 0.22
328 0.26
329 0.25
330 0.25
331 0.26
332 0.28
333 0.23
334 0.22
335 0.19
336 0.15
337 0.16
338 0.16
339 0.15
340 0.14
341 0.14
342 0.13
343 0.11
344 0.12
345 0.11
346 0.14
347 0.15
348 0.14
349 0.14
350 0.15
351 0.15
352 0.15
353 0.17
354 0.13
355 0.16
356 0.16
357 0.16
358 0.15
359 0.18
360 0.18
361 0.17
362 0.22
363 0.19
364 0.2
365 0.21
366 0.23
367 0.24
368 0.25
369 0.3
370 0.25
371 0.25
372 0.24
373 0.23
374 0.21
375 0.18
376 0.17
377 0.12
378 0.12
379 0.1
380 0.1
381 0.1
382 0.09
383 0.09
384 0.09
385 0.09
386 0.08
387 0.1
388 0.14
389 0.15
390 0.15
391 0.19
392 0.25
393 0.34
394 0.43
395 0.47
396 0.48
397 0.55
398 0.58
399 0.6
400 0.63
401 0.6
402 0.56
403 0.55
404 0.59
405 0.57
406 0.54
407 0.48
408 0.4
409 0.39
410 0.35
411 0.32
412 0.26