Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G7XUZ9

Protein Details
Accession G7XUZ9    Localization Confidence Low Confidence Score 6.2
NoLS Segment(s)
PositionSequenceProtein Nature
111-130LSEGRKSTWHRDKRELRNAVHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 20, nucl 3, pero 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR014752  Arrestin-like_C  
IPR011021  Arrestin-like_N  
IPR011022  Arrestin_C-like  
IPR014756  Ig_E-set  
Pfam View protein in Pfam  
PF02752  Arrestin_C  
PF00339  Arrestin_N  
Amino Acid Sequences MLRQSLSIAKKATRKLYTHDDSSDLSLDLNITEPAVFVPTFTNKPAVLRGTCQLRLKNNLTVKRLTVNFRGTSRVTWPHGLHDTQTVTDSTLTLVSPQASDPALPCYSSALSEGRKSTWHRDKRELRNAVPSTLCMDGTHGKAAGPKYQRLPAGTHTYEFEMVLHSHLPESIEIRQSHVQYRVRACVECPGFLKRSFAKKQAIATVHCPAEDDVEDAEPAYVARAWKGLLQCGILVSRRGAPLGDRLPVTVSLTESRKSEFRGLQVFLSENVQYHQKDGLACCPGPFRRVILYEKVEKTGPTMSLHRAENVDDERPESAAKDDGALAKLVGDPEIPSGLEAAEEETVMDLTLQLPDCHLHCVSTGTQGMHYDTKYKNVRVSHWLEFVFMVSPRDNTLGSSSERIVQKVAKVPLALRSCYAQHTNASLPAYGDA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.55
2 0.57
3 0.64
4 0.64
5 0.63
6 0.58
7 0.52
8 0.46
9 0.45
10 0.4
11 0.29
12 0.23
13 0.18
14 0.16
15 0.12
16 0.12
17 0.09
18 0.08
19 0.07
20 0.07
21 0.07
22 0.09
23 0.09
24 0.08
25 0.12
26 0.17
27 0.19
28 0.21
29 0.24
30 0.22
31 0.24
32 0.29
33 0.31
34 0.28
35 0.29
36 0.34
37 0.38
38 0.43
39 0.47
40 0.47
41 0.48
42 0.54
43 0.55
44 0.57
45 0.59
46 0.61
47 0.59
48 0.57
49 0.53
50 0.51
51 0.52
52 0.49
53 0.47
54 0.46
55 0.46
56 0.44
57 0.47
58 0.41
59 0.39
60 0.39
61 0.39
62 0.37
63 0.39
64 0.38
65 0.4
66 0.43
67 0.41
68 0.36
69 0.34
70 0.32
71 0.26
72 0.27
73 0.21
74 0.17
75 0.17
76 0.15
77 0.11
78 0.1
79 0.09
80 0.09
81 0.09
82 0.09
83 0.09
84 0.09
85 0.1
86 0.1
87 0.1
88 0.1
89 0.14
90 0.14
91 0.13
92 0.13
93 0.14
94 0.14
95 0.14
96 0.15
97 0.14
98 0.16
99 0.2
100 0.21
101 0.19
102 0.24
103 0.28
104 0.36
105 0.43
106 0.5
107 0.53
108 0.62
109 0.71
110 0.77
111 0.83
112 0.8
113 0.72
114 0.73
115 0.68
116 0.61
117 0.51
118 0.41
119 0.33
120 0.27
121 0.24
122 0.14
123 0.15
124 0.15
125 0.16
126 0.17
127 0.14
128 0.14
129 0.17
130 0.19
131 0.23
132 0.23
133 0.25
134 0.27
135 0.32
136 0.33
137 0.32
138 0.33
139 0.31
140 0.36
141 0.33
142 0.3
143 0.27
144 0.26
145 0.25
146 0.22
147 0.17
148 0.1
149 0.1
150 0.1
151 0.09
152 0.08
153 0.08
154 0.08
155 0.09
156 0.07
157 0.09
158 0.11
159 0.16
160 0.16
161 0.2
162 0.23
163 0.24
164 0.27
165 0.32
166 0.33
167 0.33
168 0.35
169 0.37
170 0.35
171 0.34
172 0.31
173 0.31
174 0.28
175 0.25
176 0.24
177 0.22
178 0.23
179 0.23
180 0.27
181 0.23
182 0.31
183 0.33
184 0.38
185 0.39
186 0.39
187 0.41
188 0.44
189 0.42
190 0.35
191 0.34
192 0.33
193 0.28
194 0.25
195 0.23
196 0.17
197 0.16
198 0.14
199 0.11
200 0.07
201 0.07
202 0.07
203 0.07
204 0.06
205 0.05
206 0.04
207 0.04
208 0.05
209 0.04
210 0.05
211 0.05
212 0.06
213 0.09
214 0.09
215 0.1
216 0.1
217 0.1
218 0.1
219 0.1
220 0.11
221 0.09
222 0.09
223 0.09
224 0.1
225 0.1
226 0.1
227 0.1
228 0.1
229 0.15
230 0.16
231 0.17
232 0.15
233 0.15
234 0.16
235 0.16
236 0.16
237 0.11
238 0.11
239 0.12
240 0.14
241 0.15
242 0.15
243 0.16
244 0.16
245 0.18
246 0.23
247 0.21
248 0.23
249 0.27
250 0.27
251 0.26
252 0.26
253 0.23
254 0.18
255 0.18
256 0.14
257 0.1
258 0.1
259 0.14
260 0.13
261 0.14
262 0.14
263 0.14
264 0.16
265 0.17
266 0.21
267 0.2
268 0.2
269 0.19
270 0.23
271 0.23
272 0.23
273 0.22
274 0.19
275 0.19
276 0.23
277 0.26
278 0.28
279 0.31
280 0.37
281 0.38
282 0.38
283 0.35
284 0.31
285 0.3
286 0.26
287 0.23
288 0.19
289 0.2
290 0.22
291 0.26
292 0.27
293 0.26
294 0.24
295 0.23
296 0.25
297 0.25
298 0.24
299 0.2
300 0.2
301 0.19
302 0.19
303 0.18
304 0.14
305 0.13
306 0.11
307 0.11
308 0.11
309 0.12
310 0.13
311 0.14
312 0.13
313 0.11
314 0.1
315 0.11
316 0.1
317 0.09
318 0.07
319 0.07
320 0.08
321 0.09
322 0.08
323 0.07
324 0.07
325 0.07
326 0.06
327 0.06
328 0.06
329 0.06
330 0.06
331 0.06
332 0.06
333 0.06
334 0.06
335 0.05
336 0.04
337 0.04
338 0.08
339 0.08
340 0.08
341 0.09
342 0.11
343 0.12
344 0.16
345 0.15
346 0.13
347 0.13
348 0.16
349 0.16
350 0.2
351 0.22
352 0.19
353 0.21
354 0.22
355 0.24
356 0.24
357 0.24
358 0.26
359 0.24
360 0.32
361 0.38
362 0.4
363 0.42
364 0.43
365 0.47
366 0.49
367 0.54
368 0.51
369 0.49
370 0.46
371 0.41
372 0.37
373 0.33
374 0.27
375 0.22
376 0.2
377 0.15
378 0.16
379 0.17
380 0.19
381 0.18
382 0.17
383 0.19
384 0.19
385 0.21
386 0.23
387 0.22
388 0.27
389 0.29
390 0.28
391 0.29
392 0.28
393 0.31
394 0.36
395 0.38
396 0.35
397 0.34
398 0.35
399 0.41
400 0.42
401 0.38
402 0.32
403 0.32
404 0.31
405 0.35
406 0.37
407 0.31
408 0.29
409 0.33
410 0.34
411 0.35
412 0.34
413 0.29