Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A401GHC3

Protein Details
Accession A0A401GHC3    Localization Confidence Medium Confidence Score 13.2
NoLS Segment(s)
PositionSequenceProtein Nature
68-87MMEIRRQGRRRPNSGQRPDGHydrophilic
NLS Segment(s)
PositionSequence
9-17KRAPAQKRA
Subcellular Location(s) nucl 16, mito 5, cyto 5, cyto_mito 5
Family & Domain DBs
Amino Acid Sequences MHENGSARKRAPAQKRALRGSPQGIKVGEEKGGDNGPGAEEGDGVDNDNGEEEEADMATEELADIAGMMEIRRQGRRRPNSGQRPDGACGLFVRDKQRLRSGS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.68
2 0.75
3 0.76
4 0.74
5 0.7
6 0.66
7 0.65
8 0.61
9 0.55
10 0.51
11 0.44
12 0.4
13 0.36
14 0.32
15 0.26
16 0.2
17 0.18
18 0.16
19 0.16
20 0.14
21 0.12
22 0.11
23 0.09
24 0.08
25 0.08
26 0.06
27 0.05
28 0.05
29 0.06
30 0.06
31 0.06
32 0.06
33 0.05
34 0.05
35 0.05
36 0.05
37 0.04
38 0.04
39 0.03
40 0.03
41 0.03
42 0.03
43 0.03
44 0.03
45 0.03
46 0.03
47 0.02
48 0.02
49 0.02
50 0.02
51 0.02
52 0.02
53 0.02
54 0.03
55 0.03
56 0.04
57 0.07
58 0.1
59 0.16
60 0.19
61 0.27
62 0.38
63 0.47
64 0.54
65 0.61
66 0.7
67 0.75
68 0.81
69 0.79
70 0.74
71 0.7
72 0.65
73 0.59
74 0.48
75 0.38
76 0.3
77 0.29
78 0.27
79 0.26
80 0.3
81 0.33
82 0.38
83 0.43