Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A428SH99

Protein Details
Accession A0A428SH99    Localization Confidence Medium Confidence Score 10.2
NoLS Segment(s)
PositionSequenceProtein Nature
142-163DCPFCHRRSETRVRKKPSNATQHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 20, cyto_nucl 13.5, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR006629  LITAF  
Pfam View protein in Pfam  
PF10601  zf-LITAF-like  
Amino Acid Sequences MDPERTLSPQPPPTYSEATMSALTSDGFAVSPMSERYNPLAQVTVSPLGTPIPPSADTFTAKPGIEHERPIENESSRGINDDCLPEVVSNAVVRVDQRVAETPDDRIEYVSSLEVMSITPRSVTPRTVTPLHMLGDQPESIDCPFCHRRSETRVRKKPSNATQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.45
2 0.43
3 0.38
4 0.32
5 0.32
6 0.3
7 0.26
8 0.21
9 0.15
10 0.14
11 0.11
12 0.09
13 0.06
14 0.06
15 0.06
16 0.06
17 0.06
18 0.07
19 0.08
20 0.12
21 0.12
22 0.14
23 0.18
24 0.22
25 0.22
26 0.21
27 0.22
28 0.18
29 0.19
30 0.2
31 0.18
32 0.14
33 0.13
34 0.13
35 0.12
36 0.12
37 0.12
38 0.09
39 0.09
40 0.1
41 0.12
42 0.14
43 0.15
44 0.17
45 0.16
46 0.18
47 0.18
48 0.17
49 0.16
50 0.17
51 0.22
52 0.21
53 0.22
54 0.22
55 0.23
56 0.24
57 0.26
58 0.26
59 0.19
60 0.19
61 0.18
62 0.17
63 0.13
64 0.14
65 0.12
66 0.1
67 0.11
68 0.11
69 0.1
70 0.09
71 0.1
72 0.08
73 0.08
74 0.07
75 0.06
76 0.05
77 0.05
78 0.05
79 0.05
80 0.05
81 0.06
82 0.07
83 0.07
84 0.08
85 0.11
86 0.13
87 0.15
88 0.15
89 0.15
90 0.17
91 0.18
92 0.16
93 0.14
94 0.13
95 0.11
96 0.11
97 0.1
98 0.08
99 0.07
100 0.07
101 0.06
102 0.06
103 0.06
104 0.06
105 0.06
106 0.07
107 0.07
108 0.13
109 0.14
110 0.16
111 0.18
112 0.22
113 0.27
114 0.29
115 0.3
116 0.28
117 0.3
118 0.29
119 0.28
120 0.24
121 0.21
122 0.21
123 0.19
124 0.16
125 0.13
126 0.14
127 0.13
128 0.16
129 0.14
130 0.19
131 0.27
132 0.28
133 0.34
134 0.37
135 0.44
136 0.5
137 0.62
138 0.65
139 0.69
140 0.77
141 0.8
142 0.85
143 0.86