Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A428THF8

Protein Details
Accession A0A428THF8    Localization Confidence Medium Confidence Score 13
NoLS Segment(s)
PositionSequenceProtein Nature
92-114GAGVERKTKKRNNKGVEKDQDQQHydrophilic
NLS Segment(s)
PositionSequence
100-101KK
Subcellular Location(s) nucl 13, cyto 8, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR025313  DUF4217  
Gene Ontology GO:0004386  F:helicase activity  
Pfam View protein in Pfam  
PF13959  DUF4217  
Amino Acid Sequences MMTKLEFPVETSAKPDDGTSYHNKAESLQLHIEQRLLEDTKRLELARNGFKSHIRAYATHTKEERKHFDISELHLGHTAKSYGLREAPGGIGAGVERKTKKRNNKGVEKDQDQQAGDEWQNQNIIKKKSMMLMNSAADEFNIG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.22
3 0.17
4 0.16
5 0.22
6 0.25
7 0.28
8 0.29
9 0.3
10 0.3
11 0.28
12 0.34
13 0.3
14 0.29
15 0.26
16 0.28
17 0.29
18 0.29
19 0.29
20 0.21
21 0.2
22 0.19
23 0.18
24 0.15
25 0.16
26 0.17
27 0.18
28 0.2
29 0.19
30 0.18
31 0.2
32 0.27
33 0.32
34 0.33
35 0.33
36 0.32
37 0.34
38 0.35
39 0.33
40 0.31
41 0.24
42 0.23
43 0.28
44 0.36
45 0.36
46 0.37
47 0.37
48 0.38
49 0.42
50 0.47
51 0.47
52 0.4
53 0.41
54 0.36
55 0.39
56 0.35
57 0.33
58 0.34
59 0.28
60 0.25
61 0.25
62 0.25
63 0.2
64 0.19
65 0.16
66 0.09
67 0.1
68 0.11
69 0.1
70 0.11
71 0.11
72 0.1
73 0.11
74 0.11
75 0.09
76 0.08
77 0.06
78 0.05
79 0.05
80 0.07
81 0.08
82 0.11
83 0.13
84 0.18
85 0.27
86 0.35
87 0.46
88 0.55
89 0.64
90 0.7
91 0.78
92 0.84
93 0.86
94 0.87
95 0.81
96 0.76
97 0.7
98 0.64
99 0.54
100 0.45
101 0.35
102 0.31
103 0.27
104 0.29
105 0.25
106 0.22
107 0.25
108 0.26
109 0.31
110 0.34
111 0.38
112 0.33
113 0.35
114 0.36
115 0.39
116 0.44
117 0.39
118 0.36
119 0.38
120 0.36
121 0.35
122 0.34
123 0.27