Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A428SWJ8

Protein Details
Accession A0A428SWJ8    Localization Confidence High Confidence Score 18.4
NoLS Segment(s)
PositionSequenceProtein Nature
13-41AEKGTDFKKLKLKRKQKEAEKRNKAARRGBasic
92-113KDSPQVKKERLARSKEGRRRGGBasic
NLS Segment(s)
PositionSequence
19-41FKKLKLKRKQKEAEKRNKAARRG
98-114KKERLARSKEGRRRGGG
Subcellular Location(s) nucl 24.5, cyto_nucl 14
Family & Domain DBs
Amino Acid Sequences MVTKGKLKMALAAEKGTDFKKLKLKRKQKEAEKRNKAARRGAAEESDEEEEVENEVAEDDDDEDDEEEEVQYNLEGIDDSDDSDSSIELEEKDSPQVKKERLARSKEGRRRGGG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.3
3 0.25
4 0.28
5 0.23
6 0.25
7 0.34
8 0.42
9 0.51
10 0.6
11 0.7
12 0.72
13 0.81
14 0.86
15 0.88
16 0.9
17 0.91
18 0.91
19 0.9
20 0.88
21 0.87
22 0.84
23 0.78
24 0.74
25 0.69
26 0.63
27 0.58
28 0.52
29 0.44
30 0.38
31 0.34
32 0.3
33 0.25
34 0.19
35 0.14
36 0.12
37 0.1
38 0.09
39 0.08
40 0.05
41 0.04
42 0.04
43 0.04
44 0.03
45 0.03
46 0.03
47 0.03
48 0.04
49 0.04
50 0.04
51 0.04
52 0.04
53 0.05
54 0.04
55 0.05
56 0.05
57 0.04
58 0.04
59 0.04
60 0.04
61 0.04
62 0.04
63 0.03
64 0.05
65 0.05
66 0.06
67 0.07
68 0.07
69 0.07
70 0.07
71 0.07
72 0.06
73 0.06
74 0.06
75 0.06
76 0.08
77 0.1
78 0.1
79 0.16
80 0.21
81 0.21
82 0.27
83 0.34
84 0.35
85 0.41
86 0.49
87 0.55
88 0.58
89 0.65
90 0.68
91 0.72
92 0.8
93 0.81
94 0.83