Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A428SVL4

Protein Details
Accession A0A428SVL4    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
50-71RKEICFRVPKGRNRNNSRRGTLHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 21, cyto 3.5, cyto_mito 3.5
Family & Domain DBs
Amino Acid Sequences MVHFGVDALTGWVSHSGWAVNSGAPVSVAASLSRGSHSRFRKEFAFHLCRKEICFRVPKGRNRNNSRRGTLTTILGTNITPALRDNCFILRHQL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.09
3 0.08
4 0.08
5 0.1
6 0.1
7 0.09
8 0.09
9 0.09
10 0.08
11 0.08
12 0.07
13 0.06
14 0.06
15 0.06
16 0.05
17 0.06
18 0.07
19 0.07
20 0.09
21 0.09
22 0.12
23 0.19
24 0.24
25 0.32
26 0.33
27 0.35
28 0.38
29 0.39
30 0.41
31 0.42
32 0.45
33 0.39
34 0.42
35 0.42
36 0.39
37 0.38
38 0.39
39 0.33
40 0.3
41 0.35
42 0.34
43 0.42
44 0.49
45 0.56
46 0.61
47 0.67
48 0.72
49 0.76
50 0.83
51 0.82
52 0.82
53 0.77
54 0.71
55 0.67
56 0.63
57 0.55
58 0.47
59 0.4
60 0.33
61 0.29
62 0.24
63 0.2
64 0.14
65 0.14
66 0.11
67 0.09
68 0.11
69 0.14
70 0.15
71 0.16
72 0.18
73 0.21
74 0.23