Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A428SPI7

Protein Details
Accession A0A428SPI7    Localization Confidence Medium Confidence Score 11.9
NoLS Segment(s)
PositionSequenceProtein Nature
49-73NSVCDPCFQKGKKKREKDRDNCILSHydrophilic
NLS Segment(s)
PositionSequence
60-63KKKR
Subcellular Location(s) nucl 12.5, mito 12, cyto_nucl 7.5
Family & Domain DBs
Amino Acid Sequences MCRKLTIVTSCSKCWFLMNTKFEDEICDQAKGKLGGCKFGIQTDRIEYNSVCDPCFQKGKKKREKDRDNCILS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.33
3 0.32
4 0.37
5 0.38
6 0.39
7 0.4
8 0.4
9 0.37
10 0.37
11 0.3
12 0.25
13 0.23
14 0.21
15 0.19
16 0.19
17 0.22
18 0.19
19 0.19
20 0.18
21 0.16
22 0.18
23 0.18
24 0.2
25 0.16
26 0.19
27 0.2
28 0.17
29 0.18
30 0.18
31 0.19
32 0.18
33 0.19
34 0.16
35 0.17
36 0.23
37 0.22
38 0.19
39 0.19
40 0.21
41 0.23
42 0.32
43 0.32
44 0.37
45 0.46
46 0.57
47 0.65
48 0.74
49 0.81
50 0.83
51 0.92
52 0.91
53 0.92