Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A428T1V7

Protein Details
Accession A0A428T1V7    Localization Confidence Medium Confidence Score 11.8
NoLS Segment(s)
PositionSequenceProtein Nature
7-42AQQVPKATTGKRPPTRKRKRIRRSPQPRPRSARFIPHydrophilic
NLS Segment(s)
PositionSequence
16-38GKRPPTRKRKRIRRSPQPRPRSA
Subcellular Location(s) nucl 11, mito 9, cyto_nucl 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR009072  Histone-fold  
Gene Ontology GO:0046982  F:protein heterodimerization activity  
Amino Acid Sequences MLSTPPAQQVPKATTGKRPPTRKRKRIRRSPQPRPRSARFIPPWTMTHPEPLSLRDMRNVPDDATTHGARMAVDHFLEFQIKPRALSLLQKEAERFIIKRFTSANNFAERMGRTTIEVQDVKRADELREMFKQLGIPALKALAVSEKFKRAL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.45
2 0.54
3 0.62
4 0.66
5 0.72
6 0.74
7 0.8
8 0.89
9 0.9
10 0.91
11 0.92
12 0.94
13 0.95
14 0.95
15 0.95
16 0.95
17 0.96
18 0.95
19 0.94
20 0.93
21 0.9
22 0.85
23 0.83
24 0.75
25 0.74
26 0.69
27 0.65
28 0.6
29 0.55
30 0.51
31 0.46
32 0.47
33 0.37
34 0.38
35 0.32
36 0.29
37 0.26
38 0.26
39 0.27
40 0.24
41 0.24
42 0.21
43 0.22
44 0.22
45 0.24
46 0.23
47 0.19
48 0.18
49 0.18
50 0.17
51 0.2
52 0.18
53 0.14
54 0.14
55 0.14
56 0.12
57 0.12
58 0.1
59 0.07
60 0.07
61 0.07
62 0.07
63 0.07
64 0.08
65 0.07
66 0.1
67 0.14
68 0.15
69 0.15
70 0.15
71 0.16
72 0.16
73 0.21
74 0.21
75 0.23
76 0.24
77 0.25
78 0.25
79 0.24
80 0.26
81 0.23
82 0.2
83 0.15
84 0.22
85 0.21
86 0.23
87 0.24
88 0.26
89 0.3
90 0.35
91 0.35
92 0.32
93 0.33
94 0.31
95 0.33
96 0.29
97 0.26
98 0.22
99 0.19
100 0.17
101 0.19
102 0.2
103 0.23
104 0.24
105 0.22
106 0.27
107 0.28
108 0.27
109 0.27
110 0.27
111 0.22
112 0.28
113 0.3
114 0.28
115 0.31
116 0.33
117 0.3
118 0.3
119 0.3
120 0.23
121 0.28
122 0.22
123 0.2
124 0.18
125 0.18
126 0.17
127 0.15
128 0.15
129 0.15
130 0.17
131 0.21
132 0.24