Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A428UCY2

Protein Details
Accession A0A428UCY2    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
228-253WELETRKQDYKKGRKHGDRYDGKAGSBasic
NLS Segment(s)
Subcellular Location(s) cyto_mito 13, mito 12, cyto 12
Family & Domain DBs
InterPro View protein in InterPro  
IPR032675  LRR_dom_sf  
Amino Acid Sequences MPPVRTTKQNTAATDAAAAPVAKRPKTMWLKPIPKGDKEAYFQSSERDWDDKYEAKIGTGTRTIKFGYEFILTDRHVEDILALGPGVCGGLWQFIFEYTDVSYDAKNSAKLTTQVVVRLAKACPKLRRIELQAATEVGEDALLALFENCPALTYIELSGLGHGNDITGSSLDALRENPEWAPKLKTLVLGERDEKKAFMKAMRALGKERQAMTITLISRMEVKKWGDWELETRKQDYKKGRKHGDRYDGKAGSNPLDNRYNYYW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.44
2 0.34
3 0.25
4 0.19
5 0.17
6 0.11
7 0.16
8 0.22
9 0.21
10 0.23
11 0.24
12 0.33
13 0.43
14 0.49
15 0.52
16 0.57
17 0.64
18 0.69
19 0.78
20 0.74
21 0.67
22 0.67
23 0.62
24 0.57
25 0.53
26 0.52
27 0.45
28 0.42
29 0.39
30 0.36
31 0.33
32 0.29
33 0.29
34 0.26
35 0.23
36 0.23
37 0.27
38 0.28
39 0.28
40 0.31
41 0.28
42 0.26
43 0.28
44 0.25
45 0.25
46 0.26
47 0.27
48 0.22
49 0.24
50 0.24
51 0.22
52 0.23
53 0.19
54 0.16
55 0.15
56 0.15
57 0.14
58 0.18
59 0.17
60 0.17
61 0.17
62 0.15
63 0.13
64 0.12
65 0.11
66 0.08
67 0.08
68 0.06
69 0.05
70 0.05
71 0.04
72 0.04
73 0.04
74 0.03
75 0.02
76 0.03
77 0.05
78 0.05
79 0.05
80 0.06
81 0.06
82 0.07
83 0.07
84 0.08
85 0.06
86 0.07
87 0.08
88 0.08
89 0.08
90 0.08
91 0.1
92 0.1
93 0.11
94 0.11
95 0.11
96 0.12
97 0.13
98 0.15
99 0.15
100 0.15
101 0.15
102 0.17
103 0.17
104 0.16
105 0.17
106 0.15
107 0.17
108 0.22
109 0.26
110 0.28
111 0.31
112 0.35
113 0.36
114 0.41
115 0.41
116 0.44
117 0.41
118 0.38
119 0.34
120 0.3
121 0.27
122 0.22
123 0.17
124 0.09
125 0.06
126 0.04
127 0.03
128 0.03
129 0.02
130 0.02
131 0.02
132 0.02
133 0.03
134 0.03
135 0.03
136 0.04
137 0.04
138 0.05
139 0.05
140 0.06
141 0.06
142 0.06
143 0.07
144 0.06
145 0.06
146 0.07
147 0.06
148 0.06
149 0.05
150 0.05
151 0.04
152 0.05
153 0.04
154 0.04
155 0.04
156 0.05
157 0.05
158 0.06
159 0.07
160 0.07
161 0.09
162 0.09
163 0.11
164 0.11
165 0.14
166 0.16
167 0.17
168 0.2
169 0.18
170 0.21
171 0.21
172 0.24
173 0.23
174 0.27
175 0.3
176 0.3
177 0.33
178 0.35
179 0.37
180 0.34
181 0.33
182 0.28
183 0.28
184 0.27
185 0.26
186 0.26
187 0.27
188 0.35
189 0.39
190 0.4
191 0.4
192 0.43
193 0.46
194 0.45
195 0.41
196 0.36
197 0.32
198 0.31
199 0.3
200 0.29
201 0.23
202 0.22
203 0.21
204 0.18
205 0.22
206 0.23
207 0.21
208 0.22
209 0.24
210 0.26
211 0.28
212 0.31
213 0.28
214 0.29
215 0.35
216 0.38
217 0.44
218 0.43
219 0.44
220 0.48
221 0.49
222 0.56
223 0.58
224 0.6
225 0.62
226 0.7
227 0.77
228 0.81
229 0.87
230 0.89
231 0.89
232 0.87
233 0.85
234 0.84
235 0.75
236 0.66
237 0.61
238 0.54
239 0.46
240 0.45
241 0.4
242 0.35
243 0.4
244 0.4