Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A428UE34

Protein Details
Accession A0A428UE34    Localization Confidence Medium Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
10-39QSNEENKMAKKPREKKKEKGSRSTQPQIRPHydrophilic
NLS Segment(s)
PositionSequence
16-31KMAKKPREKKKEKGSR
Subcellular Location(s) nucl 14.5, cyto_nucl 12.5, cyto 9.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR021860  Peptidase_S12_Pab87-rel_C  
Pfam View protein in Pfam  
PF11954  DUF3471  
Amino Acid Sequences MAKKKAQGNQSNEENKMAKKPREKKKEKGSRSTQPQIRPLDQYTGYYWNAGYHGMNVEIKDDALFIDATDRSMAFTLTFEHERDQTKYTAHLSDFWEGGDDLIPAEFVFDGEKAVKMGLDLEPLIGDKIWFERKD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.55
2 0.48
3 0.51
4 0.51
5 0.49
6 0.54
7 0.62
8 0.68
9 0.76
10 0.82
11 0.83
12 0.86
13 0.89
14 0.87
15 0.88
16 0.86
17 0.85
18 0.86
19 0.86
20 0.81
21 0.76
22 0.74
23 0.7
24 0.64
25 0.57
26 0.5
27 0.45
28 0.39
29 0.35
30 0.3
31 0.28
32 0.25
33 0.21
34 0.19
35 0.15
36 0.14
37 0.13
38 0.11
39 0.08
40 0.08
41 0.09
42 0.1
43 0.09
44 0.09
45 0.08
46 0.08
47 0.07
48 0.06
49 0.05
50 0.05
51 0.05
52 0.04
53 0.06
54 0.06
55 0.06
56 0.06
57 0.06
58 0.06
59 0.06
60 0.06
61 0.05
62 0.05
63 0.06
64 0.09
65 0.11
66 0.11
67 0.12
68 0.15
69 0.17
70 0.2
71 0.21
72 0.19
73 0.18
74 0.2
75 0.21
76 0.21
77 0.19
78 0.2
79 0.21
80 0.21
81 0.21
82 0.18
83 0.17
84 0.14
85 0.14
86 0.11
87 0.08
88 0.06
89 0.06
90 0.06
91 0.04
92 0.05
93 0.04
94 0.04
95 0.05
96 0.05
97 0.07
98 0.07
99 0.08
100 0.08
101 0.08
102 0.08
103 0.07
104 0.09
105 0.09
106 0.1
107 0.1
108 0.1
109 0.1
110 0.11
111 0.11
112 0.1
113 0.09
114 0.07
115 0.13