Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A428SZ89

Protein Details
Accession A0A428SZ89    Localization Confidence High Confidence Score 15
NoLS Segment(s)
PositionSequenceProtein Nature
208-231GESACRGRIRRNTRPIKMNIPRAEHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 26
Family & Domain DBs
InterPro View protein in InterPro  
IPR004827  bZIP  
IPR013950  Mis14/Nsl1  
Gene Ontology GO:0000776  C:kinetochore  
GO:0003700  F:DNA-binding transcription factor activity  
GO:0000070  P:mitotic sister chromatid segregation  
Pfam View protein in Pfam  
PF08641  Mis14  
PROSITE View protein in PROSITE  
PS00036  BZIP_BASIC  
Amino Acid Sequences MDSESVVSQVQRKVELQSPDDLTYLIANVRRAAAERLNEAFPVVEGNDGEDELRNQIETLVNEYIDKTFTLASPNLSINGLPVSSESFLSGSDAEPEPVYEPFDTRKRRRVADLITQEEKLLEDVAALKRSVPATAAANQAEQLRDSLKRDDDMLEARKKQVAAEAADVDIDDKTLERQESVEAGFRKAVEGLGRLKTRDARRRGQNGESACRGRIRRNTRPIKMNIPRAETCMISGANYGV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.37
3 0.34
4 0.37
5 0.39
6 0.37
7 0.36
8 0.32
9 0.26
10 0.2
11 0.18
12 0.15
13 0.14
14 0.13
15 0.14
16 0.15
17 0.15
18 0.17
19 0.2
20 0.22
21 0.22
22 0.25
23 0.27
24 0.27
25 0.27
26 0.25
27 0.2
28 0.15
29 0.14
30 0.1
31 0.08
32 0.07
33 0.09
34 0.09
35 0.09
36 0.09
37 0.09
38 0.09
39 0.09
40 0.1
41 0.08
42 0.08
43 0.09
44 0.11
45 0.11
46 0.15
47 0.15
48 0.15
49 0.15
50 0.15
51 0.15
52 0.12
53 0.12
54 0.08
55 0.08
56 0.08
57 0.11
58 0.11
59 0.12
60 0.14
61 0.14
62 0.14
63 0.14
64 0.13
65 0.1
66 0.1
67 0.09
68 0.06
69 0.06
70 0.07
71 0.07
72 0.08
73 0.07
74 0.07
75 0.07
76 0.08
77 0.08
78 0.06
79 0.09
80 0.09
81 0.09
82 0.09
83 0.09
84 0.09
85 0.09
86 0.11
87 0.08
88 0.09
89 0.12
90 0.2
91 0.29
92 0.32
93 0.4
94 0.43
95 0.45
96 0.48
97 0.5
98 0.48
99 0.49
100 0.52
101 0.49
102 0.46
103 0.44
104 0.39
105 0.33
106 0.27
107 0.18
108 0.11
109 0.06
110 0.04
111 0.07
112 0.08
113 0.09
114 0.09
115 0.09
116 0.1
117 0.11
118 0.1
119 0.08
120 0.09
121 0.1
122 0.13
123 0.15
124 0.14
125 0.14
126 0.15
127 0.15
128 0.14
129 0.12
130 0.1
131 0.09
132 0.11
133 0.13
134 0.15
135 0.15
136 0.16
137 0.17
138 0.17
139 0.17
140 0.21
141 0.25
142 0.27
143 0.27
144 0.28
145 0.29
146 0.28
147 0.26
148 0.25
149 0.22
150 0.19
151 0.2
152 0.2
153 0.18
154 0.17
155 0.17
156 0.13
157 0.09
158 0.07
159 0.05
160 0.04
161 0.05
162 0.08
163 0.09
164 0.08
165 0.09
166 0.1
167 0.12
168 0.13
169 0.18
170 0.17
171 0.18
172 0.19
173 0.18
174 0.18
175 0.16
176 0.17
177 0.12
178 0.14
179 0.17
180 0.23
181 0.25
182 0.25
183 0.28
184 0.34
185 0.42
186 0.49
187 0.52
188 0.54
189 0.63
190 0.71
191 0.74
192 0.72
193 0.68
194 0.65
195 0.65
196 0.63
197 0.55
198 0.48
199 0.48
200 0.46
201 0.48
202 0.52
203 0.54
204 0.58
205 0.66
206 0.75
207 0.77
208 0.83
209 0.81
210 0.82
211 0.81
212 0.81
213 0.77
214 0.74
215 0.67
216 0.62
217 0.58
218 0.47
219 0.39
220 0.33
221 0.27
222 0.2