Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A428TLD4

Protein Details
Accession A0A428TLD4    Localization Confidence Medium Confidence Score 12.9
NoLS Segment(s)
PositionSequenceProtein Nature
29-55KRPPPTKTACWGCRKRKAKCDGQRPACHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 23, mito 2, cyto 2, cyto_mito 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR036864  Zn2-C6_fun-type_DNA-bd_sf  
IPR001138  Zn2Cys6_DnaBD  
Gene Ontology GO:0005634  C:nucleus  
GO:0000981  F:DNA-binding transcription factor activity, RNA polymerase II-specific  
GO:0008270  F:zinc ion binding  
Pfam View protein in Pfam  
PF00172  Zn_clus  
PROSITE View protein in PROSITE  
PS50048  ZN2_CY6_FUNGAL_2  
CDD cd00067  GAL4  
Amino Acid Sequences MAMNYRPIKPAPLMDGSHRIDKSTRSAPKRPPPTKTACWGCRKRKAKCDGQRPACANCIKINKRMRLRYQDERFKYKGSSARQPRAPRTAGCFKSASQTAGVRCSGSSRSYSGLFGGQQAASGDYSSVED
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.41
3 0.4
4 0.44
5 0.41
6 0.38
7 0.34
8 0.34
9 0.36
10 0.38
11 0.44
12 0.44
13 0.51
14 0.6
15 0.68
16 0.77
17 0.76
18 0.73
19 0.71
20 0.72
21 0.7
22 0.69
23 0.68
24 0.65
25 0.7
26 0.74
27 0.76
28 0.78
29 0.81
30 0.8
31 0.8
32 0.8
33 0.8
34 0.8
35 0.81
36 0.81
37 0.79
38 0.79
39 0.72
40 0.66
41 0.61
42 0.52
43 0.43
44 0.38
45 0.4
46 0.36
47 0.41
48 0.46
49 0.47
50 0.54
51 0.59
52 0.6
53 0.6
54 0.64
55 0.66
56 0.67
57 0.69
58 0.66
59 0.66
60 0.61
61 0.53
62 0.48
63 0.42
64 0.41
65 0.36
66 0.42
67 0.45
68 0.51
69 0.56
70 0.61
71 0.62
72 0.61
73 0.59
74 0.51
75 0.5
76 0.52
77 0.47
78 0.44
79 0.4
80 0.34
81 0.37
82 0.37
83 0.31
84 0.24
85 0.25
86 0.24
87 0.26
88 0.26
89 0.2
90 0.18
91 0.2
92 0.19
93 0.18
94 0.19
95 0.17
96 0.2
97 0.2
98 0.21
99 0.19
100 0.2
101 0.18
102 0.17
103 0.18
104 0.14
105 0.14
106 0.14
107 0.14
108 0.12
109 0.12
110 0.11