Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A428T970

Protein Details
Accession A0A428T970    Localization Confidence Low Confidence Score 9.2
NoLS Segment(s)
PositionSequenceProtein Nature
1-20METPNKKRPRWNNDRVILQFHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 16.5, mito_nucl 12, mito 6.5, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR043502  DNA/RNA_pol_sf  
IPR001126  UmuC  
Gene Ontology GO:0005739  C:mitochondrion  
GO:0006281  P:DNA repair  
Pfam View protein in Pfam  
PF00817  IMS  
PROSITE View protein in PROSITE  
PS50173  UMUC  
Amino Acid Sequences METPNKKRPRWNNDRVILQFDYDCFYAQVFENKNPALKKLPVGVKQKNCLSTCNYNARALGLKKLMSVSEAKRMCSELVLMDGEDLTPFRDTSKILFNYFKTFFVESQG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.85
2 0.77
3 0.72
4 0.62
5 0.52
6 0.43
7 0.33
8 0.28
9 0.2
10 0.18
11 0.12
12 0.11
13 0.11
14 0.12
15 0.18
16 0.17
17 0.19
18 0.22
19 0.22
20 0.27
21 0.26
22 0.28
23 0.26
24 0.25
25 0.25
26 0.28
27 0.34
28 0.38
29 0.45
30 0.5
31 0.5
32 0.55
33 0.56
34 0.55
35 0.49
36 0.44
37 0.41
38 0.38
39 0.39
40 0.41
41 0.39
42 0.33
43 0.33
44 0.31
45 0.3
46 0.25
47 0.23
48 0.17
49 0.16
50 0.15
51 0.16
52 0.15
53 0.12
54 0.16
55 0.14
56 0.21
57 0.22
58 0.23
59 0.23
60 0.25
61 0.23
62 0.2
63 0.18
64 0.1
65 0.11
66 0.11
67 0.1
68 0.08
69 0.08
70 0.07
71 0.07
72 0.07
73 0.06
74 0.07
75 0.07
76 0.08
77 0.09
78 0.1
79 0.13
80 0.22
81 0.24
82 0.27
83 0.32
84 0.33
85 0.39
86 0.4
87 0.39
88 0.34
89 0.33