Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A428U0X8

Protein Details
Accession A0A428U0X8    Localization Confidence Low Confidence Score 6
NoLS Segment(s)
PositionSequenceProtein Nature
7-27VSTNRPIKTNRWKPLKGKLTHHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 20, nucl 3, cyto 3, cyto_nucl 3
Family & Domain DBs
Amino Acid Sequences MRRSQPVSTNRPIKTNRWKPLKGKLTHPLQHMHLGDIRARRRPQVTPPPFDPQAFQRMWANGWARVVQRSLLLGGWRWCRGPDIGRGGSAPATRGEQPNGVDLDVVFQLR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.67
2 0.69
3 0.7
4 0.71
5 0.76
6 0.74
7 0.8
8 0.81
9 0.73
10 0.71
11 0.7
12 0.69
13 0.67
14 0.64
15 0.58
16 0.5
17 0.53
18 0.45
19 0.39
20 0.32
21 0.28
22 0.28
23 0.31
24 0.31
25 0.32
26 0.33
27 0.35
28 0.35
29 0.37
30 0.43
31 0.48
32 0.51
33 0.49
34 0.52
35 0.54
36 0.52
37 0.49
38 0.41
39 0.32
40 0.32
41 0.26
42 0.23
43 0.19
44 0.18
45 0.18
46 0.22
47 0.21
48 0.15
49 0.17
50 0.18
51 0.17
52 0.17
53 0.18
54 0.13
55 0.12
56 0.11
57 0.11
58 0.1
59 0.1
60 0.11
61 0.15
62 0.18
63 0.19
64 0.19
65 0.18
66 0.2
67 0.22
68 0.23
69 0.25
70 0.3
71 0.29
72 0.3
73 0.3
74 0.29
75 0.29
76 0.26
77 0.2
78 0.14
79 0.16
80 0.18
81 0.21
82 0.23
83 0.23
84 0.24
85 0.27
86 0.27
87 0.24
88 0.21
89 0.18
90 0.18