Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A428TGS2

Protein Details
Accession A0A428TGS2    Localization Confidence Medium Confidence Score 13.4
NoLS Segment(s)
PositionSequenceProtein Nature
15-34ACLGCKARKTRCNRAKPTCDHydrophilic
38-64ARGLTCTYPNKRKRRTNVPKTRSQPMYHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 23, cyto_nucl 13
Family & Domain DBs
InterPro View protein in InterPro  
IPR036864  Zn2-C6_fun-type_DNA-bd_sf  
IPR001138  Zn2Cys6_DnaBD  
Gene Ontology GO:0005634  C:nucleus  
GO:0000981  F:DNA-binding transcription factor activity, RNA polymerase II-specific  
GO:0008270  F:zinc ion binding  
Pfam View protein in Pfam  
PF00172  Zn_clus  
PROSITE View protein in PROSITE  
PS00463  ZN2_CY6_FUNGAL_1  
PS50048  ZN2_CY6_FUNGAL_2  
CDD cd00067  GAL4  
Amino Acid Sequences MDPAAQSSKGLNELACLGCKARKTRCNRAKPTCDGCFARGLTCTYPNKRKRRTNVPKTRSQPMYVIAT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.16
3 0.15
4 0.14
5 0.15
6 0.2
7 0.25
8 0.3
9 0.37
10 0.45
11 0.55
12 0.64
13 0.72
14 0.78
15 0.81
16 0.8
17 0.8
18 0.79
19 0.7
20 0.65
21 0.55
22 0.47
23 0.41
24 0.34
25 0.27
26 0.21
27 0.2
28 0.17
29 0.22
30 0.27
31 0.31
32 0.4
33 0.49
34 0.58
35 0.66
36 0.74
37 0.77
38 0.82
39 0.86
40 0.88
41 0.9
42 0.87
43 0.87
44 0.83
45 0.84
46 0.77
47 0.69
48 0.61